From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005983000
  • symbol?:
  • description?: Putative transcriptional activator

      descriptions from strain specific annotations:

    • Putative transcriptional activator
    • transcription activator, effector binding domain-containing protein
    • Positive transcriptional activator, putative
    • endopeptidase, putative
    • AarP
  • strand?: -
  • coordinates?: 6044305..6044792
  • synteny block?: BlockID0047270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2372
    08BA02176:
    C248_2484
    11819-97:
    MS7_2449
    71193:
    ST398NM01_2487
    ECT-R 2:
    ECTR2_2293
    ED133:
    SAOV_2485c
    ED98:
    SAAV_2501
    HO 5096 0412:
    SAEMRSA15_23350
    JH1:
    SaurJH1_2510
    JH9:
    SaurJH9_2461
    JKD6008:
    SAA6008_02476
    JKD6159:
    SAA6159_02333
    LGA251:
    SARLGA251_22160
    M013:
    M013TW_2398
    MRSA252:
    SAR2525
    MSHR1132:
    SAMSHR1132_22630
    MSSA476:
    SAS2327
    Mu3:
    SAHV_2419
    Mu50:
    SAV2435
    MW2:
    MW2359
    RF122:
    SAB2317c
    ST398:
    SAPIG2487
    T0131:
    SAT0131_02632
    TCH60:
    HMPREF0772_10753
    TW20:
    SATW20_25640
    USA300_TCH1516:
    USA300HOU_2421
    VC40:
    SAVC_11050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
    N315            MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
    NCTC8325        MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
    Newman          MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
    USA300_FPR3757  MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
                    ************************************************************

    COL             CIPELDGKMSYMIAVTGDNSADIEKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
    N315            CIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
    NCTC8325        CIPELDGKMSYMIAVTGDNSADIEKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
    Newman          CIPELDGKMSYMIAVTGDNSADIEKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
    USA300_FPR3757  CIPELDGKMSYMIAVTGDNSADIEKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
                    *********************** ************************************

    COL             HQYQADTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
    N315            HQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
    NCTC8325        HQYQADTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
    Newman          HQYQADTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
    USA300_FPR3757  HQYQADTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
                    *****:*******************************