From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005996000
  • symbol?:
  • description?: integral membrane efflux protein

      descriptions from strain specific annotations:

    • integral membrane efflux protein
    • major facilitator transporter
    • drug transporter, putative
    • major facilitator superfamily protein
    • putative drug transporter
    • putative transport protein
    • MFS family major facilitator transporter
    • quinolone resistance protein norB
    • transmembrane efflux protein
    • multidrug resistance protein B
    • major facilitator family transporter
    • major facilitator superfamily protein (MFS)
  • strand?: -
  • coordinates?: 6057138..6058538
  • synteny block?: BlockID0047400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2381
    08BA02176:
    C248_2494
    11819-97:
    MS7_2458
    71193:
    ST398NM01_2496
    ECT-R 2:
    ECTR2_2302
    ED133:
    SAOV_2494c
    ED98:
    SAAV_2510
    HO 5096 0412:
    SAEMRSA15_23440
    JH1:
    SaurJH1_2519
    JH9:
    SaurJH9_2471
    JKD6008:
    SAA6008_02486
    JKD6159:
    SAA6159_02342
    LGA251:
    SARLGA251_22250
    M013:
    M013TW_2407
    MRSA252:
    SAR2534
    MSHR1132:
    SAMSHR1132_22720
    MSSA476:
    SAS2336
    Mu3:
    SAHV_2428
    Mu50:
    SAV2444
    MW2:
    MW2368
    RF122:
    SAB2326c
    ST398:
    SAPIG2496
    T0131:
    SAT0131_02643 (rnc)
    TCH60:
    HMPREF0772_10744
    TW20:
    SATW20_25730
    USA300_TCH1516:
    USA300HOU_2433
    VC40:
    SAVC_11095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDTSKQFRGDNRLLLGIVLGVITFWLFAQSLVNLVVPLQSTYSSDVGTINIAVSLSALFA
    N315            MDTSKQFRGDNRLLLGIVLGVITFWLFAQSLVNLVVPLQSTYSSDVGTINIAVSLSALFA
    NCTC8325        MDTSKQFRGDNRLLLGIVLGVITFWLFAQSLVNLVVPLQSTYSSDVGTINIAVSLSALFA
    Newman          MDTSKQFRGDNRLLLGIVLGVITFWLFAQSLVNLVVPLQSTYSSDVGTINIAVSLSALFA
    USA300_FPR3757  MDTSKQFRGDNRLLLGIVLGVITFWLFAQSLVNLVVPLQSTYSSDVGTINIAVSLSALFA
                    ************************************************************

    COL             GLFIVGAGDVADKFGRVKITYVGLILNVVGSLLIIITPLPAFLIIGRIIQGLSAACIMPS
    N315            GLFIVGAGDVADKFGRVKITYVGLILNVVGSLLIIITPLPAFLIIGRIIQGLSAACIMPS
    NCTC8325        GLFIVGAGDVADKFGRVKITYVGLILNVVGSLLIIITPLPAFLIIGRIIQGLSAACIMPS
    Newman          GLFIVGAGDVADKFGRVKITYVGLILNVVGSLLIIITPLPAFLIIGRIIQGLSAACIMPS
    USA300_FPR3757  GLFIVGAGDVADKFGRVKITYVGLILNVVGSLLIIITPLPAFLIIGRIIQGLSAACIMPS
                    ************************************************************

    COL             TLAIINEYYIGTRRQRALSYWSIGSWGGSGICTLFGGLMATYIGWRSIFVVSILLTLLAM
    N315            TLAIINEYYIGTRRQRALSYWSIGSWGGSGICTLFGGLMATYIGWRSIFVVSILLTLLAM
    NCTC8325        TLAIINEYYIGTRRQRALSYWSIGSWGGSGICTLFGGLMATYIGWRSIFVVSILLTLLAM
    Newman          TLAIINEYYIGTRRQRALSYWSIGSWGGSGICTLFGGLMATYIGWRSIFVVSILLTLLAM
    USA300_FPR3757  TLAIINEYYIGTRRQRALSYWSIGSWGGSGICTLFGGLMATYIGWRSIFVVSILLTLLAM
                    ************************************************************

    COL             YLIKHAPETKAEPIKGMKAEAKKFDVIGLVILVVTMLSLNVIITQTSHFGLVSPLILALI
    N315            YLIKHAPETKAEPIKGMKAEAKKFDVIGLVILVVTMLSLNVIITQTSHFGLVSPLILGLI
    NCTC8325        YLIKHAPETKAEPIKGMKAEAKKFDVIGLVILVVTMLSLNVIITQTSHFGLVSPLILGLI
    Newman          YLIKHAPETKAEPIKGMKAEAKKFDVIGLVILVVTMLSLNVIITQTSHFGLVSPLILALI
    USA300_FPR3757  YLIKHAPETKAEPIKGMKAEAKKFDVIGLVILVVTMLSLNVIITQTSHFGLVSPLILGLI
                    *********************************************************.**

    COL             VVFICSLVGFVYYENKIKHPLVDFSIFKNRGYSGATISNFLLNGVAGGALIVINTYYQQQ
    N315            VVFICSLVGFVYYENKIKHPLVDFSIFKNRGYSGATISNFLLNGVAGGALIVINTYYQQQ
    NCTC8325        VVFICSLVGFVYYENKIKHPLVDFSIFKNRGYSGATISNFLLNGVAGGALIVINTYYQQQ
    Newman          VVFICSLVGFVYYENKIKHPLVDFSIFKNRGYSGATISNFLLNGVAGGALIVINTYYQQQ
    USA300_FPR3757  VVFICSLVGFVYYENKIKHPLVDFSIFKNRGYSGATISNFLLNGVAGGALIVINTYYQQQ
                    ************************************************************

    COL             LGFNSSQTGYISLTYLITVLSMIRVGEKILSQHGPKRPLLLGSGFTVIGLILLSLTFLPE
    N315            LGFNSSQTGYISLTYLIAVLSMIRVGEKILSQHGPKRPLLLGSGFTVIGLILLSLTFLPE
    NCTC8325        LGFNSSQTGYISLTYLITVLSMIRVGEKILSQHGPKRPLLLGSGFTVIGLILLSLTFLPE
    Newman          LGFNSSQTGYISLTYLITVLSMIRVGEKILSQHGPKRPLLLGSGFTVIGLILLSLTFLPE
    USA300_FPR3757  LGFNSSQTGYISLTYLITVLSMIRVGEKILSQHGPKRPLLLGSGFTVIGLILLSLTFLPE
                    *****************:******************************************

    COL             VWYIISSIVGYLLFGTGLGLYATPSTDTAVASAPDDKSGVASGVYKMASSLGNAFGVAVS
    N315            VWYIISSIVGYLLFGTGLGLYATPSTDTAVASAPDDKSGVASGVYKMASSLGNAFGVAVS
    NCTC8325        VWYIISSIVGYLLFGTGLGLYATPSTDTAVASAPDDKSGVASGVYKMASSLGNAFGVAVS
    Newman          VWYIISSIVGYLLFGTGLGLYATPSTDTAVASAPDDKSGVASGVYKMASSLGNAFGVAVS
    USA300_FPR3757  VWYIISSIVGYLLFGTGLGLYATPSTDTAVASAPDDKSGVASGVYKMASSLGNAFGVAVS
                    ************************************************************

    COL             GTVYTVLAANLNLNLGGFTGMMFNALLAIVAFLVILLLVPKNQTNL
    N315            GTVYTVLAANLNLNLGGFTGMMFNALLAIVAFLVILLLVPKNQTNL
    NCTC8325        GTVYTVLAANLNLNLGGFTGMMFNALLAIVAFLVILLLVPKNQTNL
    Newman          GTVYTVLAANLNLNLGGFTGMMFNALLAIVAFLVILLLVPKNQTNL
    USA300_FPR3757  GTVYTVLAANLNLNLGGFTGMMFNALLAIVAFLVILLLVPKNQTNL
                    **********************************************