From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006008000
  • symbol?:
  • description?: chloramphenicol resistance protein

      descriptions from strain specific annotations:

    • chloramphenicol resistance protein
    • major facilitator transporter
    • drug transporter, putative
    • major facilitator superfamily protein
    • transport protein
    • putative transport protein
    • general substrate transporter involved in chloramphenicol resistance
    • major facilitator superfamily chloramphenicol:cation symporter
    • MFS family major facilitator transporter, chloramphenicol:cation symporter
    • major facilitator superfamily transporter protein
    • membrane transporter
  • strand?: -
  • coordinates?: 6068092..6069219
  • synteny block?: BlockID0047520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2389
    08BA02176:
    C248_2503
    11819-97:
    MS7_2466
    71193:
    ST398NM01_2505
    ECT-R 2:
    ECTR2_2310
    ED133:
    SAOV_2503c
    ED98:
    SAAV_2519
    HO 5096 0412:
    SAEMRSA15_23520
    JH1:
    SaurJH1_2528
    JH9:
    SaurJH9_2479
    JKD6008:
    SAA6008_02494
    JKD6159:
    SAA6159_02350
    LGA251:
    SARLGA251_22330
    M013:
    M013TW_2415
    MRSA252:
    SAR2542
    MSHR1132:
    SAMSHR1132_22800
    MSSA476:
    SAS2344
    Mu3:
    SAHV_2436
    Mu50:
    SAV2452
    MW2:
    MW2376
    RF122:
    SAB2334c
    ST398:
    SAPIG2505
    T0131:
    SAT0131_02652 (rimM)
    TCH60:
    HMPREF0772_10736
    TW20:
    SATW20_25810
    USA300_TCH1516:
    USA300HOU_2442
    VC40:
    SAVC_11135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIMRLFTFILSIFIVGMVEMMVAGIMNLMSQDLHVSEAVVGQLVTMYALTFAICGPILV
    N315            MSIMRLFTFILSIFIVGMVEMMVAGIMNLMSQDLHVSEAVVGQLVTMYALTFAICGPILV
    NCTC8325        --------------------MMVAGIMNLMSQDLHVSEAVVGQLVTMYALTFAICGPILV
    Newman          MSIMRLFTFILSIFIVGMVEMMVAGIMNLMSQDLHVSEAVVGQLVTMYALTFAICGPILV
    USA300_FPR3757  MSIMRLFTFILSIFIVGMVEMMVAGIMNLMSQDLHVSEAVVGQLVTMYALTFAICGPILV
                                        ****************************************

    COL             KLTNRFSSRPVLLWTLLIFIIGNGIIAVAPNFSILVVGRIISSAAAALIIVKVLAITAML
    N315            KLTNRFSSRPVLLWTLLIFIIGNGIIAVAPNFSILVVGRIISSAAAALIIVKVLAITAML
    NCTC8325        KLTNRFSSRPVLLWTLLIFIIGNGIIAVAPNFSILVVGRIISSAAAALIIVKVLAITAML
    Newman          KLTNRFSSRPVLLWTLLIFIIGNGIIAVAPNFSILVVGRIISSAAAALIIVKVLAITAML
    USA300_FPR3757  KLTNRFSSRPVLLWTLLIFIIGNGIIAVAPNFSILVVGRIISSAAAALIIVKVLAITAML
                    ************************************************************

    COL             SAPKNRGKMIGLVYTGFSGANVFGVPIGTVIGDLVGWRYTFLFLIIVSIIVGFLMMIYLP
    N315            SAPKNRGKMIGLVYTGFSGANVFGVPIGTVIGDLVGWRYTFLFLIIVSIIVGFLMMIYLP
    NCTC8325        SAPKNRGKMIGLVYTGFSGANVFGVPIGTVIGDLVGWRYTFLFLIIVSIIVGFLMMIYLP
    Newman          SAPKNRGKMIGLVYTGFSGANVFGVPIGTVIGDLVGWRYTFLFLIIVSIIVGFLMMIYLP
    USA300_FPR3757  SAPKNRGKMIGLVYTGFSGANVFGVPIGTVIGDLVGWRYTFLFLIIVSIIVGFLMMIYLP
                    ************************************************************

    COL             KDQEIQRGPVNHETPSHENHVTSKILRPAEVAKYLIITFLVLIANSVTFVFINPLILSNG
    N315            KDQEIQRGPVNHEAPSHENHVTSKILRPAEVAKYLIITFLVLIANSVTFVFINPLILSNG
    NCTC8325        KDQEIQRGPVNHETPSHENHVTSKILRPAEVAKYLIITFLVLIANSVTFVFINPLILSNG
    Newman          KDQEIQRGPVNHETPSHENHVTSKILRPAEVAKYLIITFLVLIANSVTFVFINPLILSNG
    USA300_FPR3757  KDQEIQRGPVNHETPSHENHVTSKILRPAEVAKYLIITFLVLIANSVTFVFINPLILSNG
                    *************:**********************************************

    COL             HDMSFVSLALLVNGIAGVIGTSLGGIFSDKITSKRWLMISVSIFIVMMLLMNLILPGSGL
    N315            HDMSFVSLALLVNGIAGVIGTSLGGIFSDKITSKRWLMISVSIFIVMMLLMNLILPGSGL
    NCTC8325        HDMSFVSLALLVNGIAGVIGTSLGGIFSDKITSKRWLMISVSIFIVMMLLMNLILPGSGL
    Newman          HDMSFVSLALLVNGIAGVIGTSLGGIFSDKITSKRWLMISVSIFIVMMLLMNLILPGSGL
    USA300_FPR3757  HDMSFVSLALLVNGIAGVIGTSLGGIFSDKITSKRWLMISVSIFIVMMLLMNLILPGSGL
                    ************************************************************

    COL             LLAGLFIWNIMQWSTNPAVQSGVIQHVEGDTSQVMSWNMSSLNAGIGVGGIIGGLVMTHV
    N315            LLAGLFIWNIMQWSTNPAVQSGVIQHVEGDTSQVMSWNMSSLNAGIGVGGIIGGLVMTHV
    NCTC8325        LLAGLFIWNIMQWSTNPAVQSGVIQHVEGDTSQVMSWNMSSLNAGIGVGGIIGGLVMTHV
    Newman          LLAGLFIWNIMQWSTNPAVQSGVIQHVEGDTSQVMSWNMSSLNAGIGVGGIIGGLVMTHV
    USA300_FPR3757  LLAGLFIWNIMQWSTNPAVQSGVIQHVEGDTSQVMSWNMSSLNAGIGVGGIIGGLVMTHV
                    ************************************************************

    COL             SVQAITYTSAIIGALGLIVVFTLKNNHYAKTFKSS
    N315            SVQAITYTSAIIGALGLIVVFTLKNNHYAKTFKSS
    NCTC8325        SVQAITYTSAIIGALGLIVVFTLKNNHYAKTFKSS
    Newman          SVQAITYTSAIIGALGLIVVFTLKNNHYAKTFKSS
    USA300_FPR3757  SVQAITYTSAIIGALGLIVVFTLKNNHYAKTFKSS
                    ***********************************