From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006012000
  • symbol?:
  • description?: peptidase M28

      descriptions from strain specific annotations:

    • peptidase M28
    • glutamyl-aminopeptidase
    • cellulase
    • endo-1,4-beta-glucanase
    • endoglucanase M
    • M42 family glutamyl aminopeptidase
    • M42 glutamyl aminopeptidase, cellulase
    • M42 glutamyl aminopeptidase family protein
    • putative aminopeptidase ysdC
    • putative peptidase
  • strand?: -
  • coordinates?: 6071525..6072601
  • synteny block?: BlockID0047560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2463 (pepA2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2392
    08BA02176:
    C248_2506
    11819-97:
    MS7_2469 (ysdC)
    71193:
    ST398NM01_2508
    ECT-R 2:
    ECTR2_2313
    ED133:
    SAOV_2506c
    ED98:
    SAAV_2522 (pepA2)
    HO 5096 0412:
    SAEMRSA15_23550
    JH1:
    SaurJH1_2531
    JH9:
    SaurJH9_2482
    JKD6008:
    SAA6008_02497 (pepA2)
    JKD6159:
    SAA6159_02353 (pepA2)
    LGA251:
    SARLGA251_22360
    M013:
    M013TW_2418
    MRSA252:
    SAR2545
    MSHR1132:
    SAMSHR1132_22830
    MSSA476:
    SAS2347
    Mu3:
    SAHV_2439
    Mu50:
    SAV2455
    MW2:
    MW2379
    RF122:
    SAB2338c
    ST398:
    SAPIG2508
    T0131:
    SAT0131_02655
    TCH60:
    HMPREF0772_10733 (pepA)
    TW20:
    SATW20_25840
    USA300_TCH1516:
    USA300HOU_2445 (pepA)
    VC40:
    SAVC_11150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
    N315            MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
    NCTC8325        MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
    Newman          MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
    USA300_FPR3757  MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
                    ************************************************************

    COL             MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
    N315            MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
    NCTC8325        MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
    Newman          MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
    USA300_FPR3757  MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
                    ************************************************************

    COL             VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
    N315            VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
    NCTC8325        VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
    Newman          VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
    USA300_FPR3757  VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
                    ************************************************************

    COL             NRYGCALAIEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
    N315            NRYGCALAVEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
    NCTC8325        NRYGCALAIEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
    Newman          NRYGCALAIEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
    USA300_FPR3757  NRYGCALAIEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
                    ********:***************************************************

    COL             DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
    N315            DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
    NCTC8325        DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
    Newman          DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
    USA300_FPR3757  DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
                    ************************************************************

    COL             GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
    N315            GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
    NCTC8325        GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
    Newman          GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
    USA300_FPR3757  GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
                    **********************************************************