From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006029000
  • symbol?:
  • description?: nicotianamine synthase

      descriptions from strain specific annotations:

    • nicotianamine synthase
    • rRNA methyltransferase FmrO
    • ribosomal RNA methyltransferase family protein
    • Methyltransferase
  • strand?: -
  • coordinates?: 6086246..6087064
  • synteny block?: BlockID0047730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2406
    08BA02176:
    C248_2519
    11819-97:
    MS7_2482
    71193:
    ST398NM01_2519
    ECT-R 2:
    ECTR2_2326
    ED133:
    SAOV_2519c
    ED98:
    SAAV_2535
    HO 5096 0412:
    SAEMRSA15_23670
    JH1:
    SaurJH1_2545
    JH9:
    SaurJH9_2496
    JKD6008:
    SAA6008_02510 (fmrO)
    JKD6159:
    SAA6159_02366 (fmrO)
    LGA251:
    SARLGA251_22490
    M013:
    M013TW_2429
    MRSA252:
    SAR2556
    MSHR1132:
    SAMSHR1132_22940
    MSSA476:
    SAS2360
    Mu3:
    SAHV_2453
    Mu50:
    SAV2469
    MW2:
    MW2393
    RF122:
    SAB2352c
    ST398:
    SAPIG2519
    T0131:
    SAT0131_02668 (xerC)
    TCH60:
    HMPREF0772_10720
    TW20:
    SATW20_25970
    USA300_TCH1516:
    USA300HOU_2460
    VC40:
    SAVC_11215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWR
    N315            MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWR
    NCTC8325        MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWR
    Newman          MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWR
    USA300_FPR3757  MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWR
                    ************************************************************

    COL             DVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIAS
    N315            DVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSITS
    NCTC8325        DVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIAS
    Newman          DVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIAS
    USA300_FPR3757  DVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIAS
                    **********************************************************:*

    COL             NDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKV
    N315            NDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKV
    NCTC8325        NDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKV
    Newman          NDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKV
    USA300_FPR3757  NDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKV
                    ************************************************************

    COL             SELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAED
    N315            SELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAED
    NCTC8325        SELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAED
    Newman          SELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAED
    USA300_FPR3757  SELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAED
                    ************************************************************

    COL             KWQCVNKHMRPQQIFDIALYKKAAIKVGITDV
    N315            KWQCVNKHMRPQQIFDIALYKKAAIKVGITDV
    NCTC8325        KWQCVNKHMRPQQIFDIALYKKAAIKVGITDV
    Newman          KWQCVNKHMRPQQIFDIALYKKAAIKVGITDV
    USA300_FPR3757  KWQCVNKHMRPQQIFDIALYKKAAIKVGITDV
                    ********************************