From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006033000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6089034..6089521
  • synteny block?: BlockID0047770
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2521
    11819-97:
    71193:
    ST398NM01_2521
    ECT-R 2:
    ED133:
    SAOV_2521c
    ED98:
    HO 5096 0412:
    SAEMRSA15_23690
    JH1:
    JH9:
    JKD6008:
    SAA6008_02512
    JKD6159:
    SAA6159_02368
    LGA251:
    SARLGA251_22510
    M013:
    M013TW_2431
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2362
    Mu3:
    Mu50:
    MW2:
    MW2395
    RF122:
    ST398:
    SAPIG2521
    T0131:
    SAT0131_02670 (hslU)
    TCH60:
    TW20:
    SATW20_25990
    USA300_TCH1516:
    USA300HOU_2462
    VC40:
    SAVC_11225

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKEKESFRLLYQAIREIADKIGDNQLETNSVSLLLLDFDFEHEVFDELYLVILKYLNTV
    NCTC8325        MLKEKESFRLLYQAIREIADKIGDNQLETNSVSLLLLDFDFEHEVFDELYLVILKYLNTV
    Newman          MLKEKESFRLLYQAIREIADKIGDNQLETNSVSLLLLDFDFEHEVFDELYLVILKYLNTV
    USA300_FPR3757  MLKEKESFRLLYQAIREIADKIGDNQLETNSVSLLLLDFDFEHEVFDELYLVILKYLNTV
                    ************************************************************

    COL             SIENISHSELLNLIENTIPEDREINTFVKNKIIIGFANNYFPELQVLANEIKSDMASSLK
    NCTC8325        SIENISHSELLNLIENTIPEDREINTFVKNKIIIGFANNYFPELQVLANEIKSDMASSLK
    Newman          SIENISHSELLNLIENTIPEDREINTFVKNKIIIGFANNYFPELQVLANEIKSDMASSLK
    USA300_FPR3757  SIENISHSELLNLIENTIPEDREINTFVKNKIIIGFANNYFPELQVLANEIKSDMASSLK
                    ************************************************************

    COL             Q
    NCTC8325        Q
    Newman          Q
    USA300_FPR3757  Q
                    *