From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006035000
  • symbol?:
  • description?: short chain dehydrogenase

      descriptions from strain specific annotations:

    • short chain dehydrogenase
    • glucose 1-dehydrogenase-like protein
    • Glutamate dehydrogenase
    • putative short-chain dehydrogenase
    • 3-oxoacyl-[acyl-carrier-protein] reductase (3-ketoacyl-acyl carrier protein reductase)
    • 3-oxoacyl-ACP reductase
    • pseudogene
    • short chain dehydrogenase family protein
  • strand?: -
  • coordinates?: 6090804..6091448
  • synteny block?: BlockID0047790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2482 (fabG2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2409
    08BA02176:
    C248_2522
    11819-97:
    MS7_2485
    71193:
    ST398NM01_2522
    ECT-R 2:
    ECTR2_2329
    ED133:
    SAOV_2522c
    ED98:
    SAAV_2538
    HO 5096 0412:
    SAEMRSA15_23700
    JH1:
    SaurJH1_2549
    JH9:
    SaurJH9_2499
    JKD6008:
    SAA6008_02513
    JKD6159:
    SAA6159_02369
    LGA251:
    SARLGA251_22520
    M013:
    M013TW_2432
    MRSA252:
    SAR2559
    MSHR1132:
    SAMSHR1132_22970
    MSSA476:
    SAS2363
    Mu3:
    SAHV_2456
    Mu50:
    SAV2472
    MW2:
    MW2396
    RF122:
    SAB2355c
    ST398:
    SAPIG2522
    T0131:
    SAT0131_02671 (codY)
    TCH60:
    HMPREF0772_10717 (fabG)
    TW20:
    SATW20_26000
    USA300_TCH1516:
    USA300HOU_2463
    VC40:
    SAVC_11230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKRLENKVAVVTGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGDNAKAYN
    NCTC8325        ---------------------------------MAVDIAEAVSETVDKIKSNGDNAKAYN
    Newman          ------------------------------------------------------------
    USA300_FPR3757  ---------------------------------MAVDIAEAVSETVDKIKSNGDNAKAYN
                                                                                

    N315            VDISDEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAAGRIHEYPIDVYDKIMNVDMRGTIL
    NCTC8325        VDNASEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAADRIHEYPIDVYDKIMNVDMRGTFL
    Newman          MDNASEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAADRIHEYPIDVYDKIMNVDMRGTFL
    USA300_FPR3757  VDNASEQQVVDFVSDIKEQFGRIDVLFNNAGVDNAADRIHEYPIDVYDKIMNVDMRGTFL
                    :* :.*******************************.*********************:*

    N315            MTKMMLPLMMNQGGSIVNTSSFSGQAEDLYRSGYNAAKGAVINFTKSIAIEYGRDGIRSN
    NCTC8325        MTKMMLPLMMNQGGSIVNTSSFSGQAADLYRSGYNAAKGAVINFTKSIAIEYGRDSIRAN
    Newman          MTKMMLPLMMNQGGSIVNTSSFSGQAADLYRSGYNAAKGAVINFTKSIAIEYGRDSIRAN
    USA300_FPR3757  MTKMMLPLMMNQGGSIVNTSSFSGQAADLYRSGYNAAKGAVINFTKSIAIEYGRDSIRAN
                    ************************** ****************************.**:*

    N315            AIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSF
    NCTC8325        AIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSF
    Newman          AIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSF
    USA300_FPR3757  AIAPGTIETPLVDKLTGTSEDDAGKTFRENQKWMTPLGRLGKPEEVAKLVVFLASDDSSF
                    ************************************************************

    N315            ITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE
    NCTC8325        ITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE
    Newman          ITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE
    USA300_FPR3757  ITGETIRIDGGVMAYTWPGEMLSDDSWKRTLE
                    ********************************