From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006037000
  • symbol?:
  • description?: transporter

      descriptions from strain specific annotations:

    • transporter
    • aminobenzoyl-glutamate transporter
    • putative transporter
    • aminobenzoyl-glutamate transport protein
    • AbgT family p-aminobenzoyl-glutamate transporter
    • AbgT transporter
    • C4-dicarboxylate anaerobic carrier family protein
    • Na+/H+ antiporter family protein
    • putative efflux pump component MtrF
    • putative transport protein
    • transporter, putative
  • strand?: +
  • coordinates?: 6091902..6093482
  • synteny block?: BlockID0047810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2410
    08BA02176:
    C248_2523
    11819-97:
    MS7_2486
    71193:
    ST398NM01_2523
    ECT-R 2:
    ECTR2_2330
    ED133:
    SAOV_2523
    ED98:
    SAAV_2539
    HO 5096 0412:
    SAEMRSA15_23710
    JH1:
    SaurJH1_2550
    JH9:
    SaurJH9_2500
    JKD6008:
    SAA6008_02514
    JKD6159:
    SAA6159_02370
    LGA251:
    SARLGA251_22530
    M013:
    M013TW_2433
    MRSA252:
    SAR2560
    MSHR1132:
    SAMSHR1132_22980
    MSSA476:
    SAS2364
    Mu3:
    SAHV_2457
    Mu50:
    SAV2473
    MW2:
    MW2397
    RF122:
    SAB2356
    ST398:
    SAPIG2523
    T0131:
    SAT0131_02672
    TCH60:
    HMPREF0772_10716
    TW20:
    SATW20_26010
    USA300_TCH1516:
    USA300HOU_2464
    VC40:
    SAVC_11240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSKHQQKGSIVNRFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHPGTH
    N315            MTSKHQQKGSIVNRFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHPGTH
    NCTC8325        MTSKHQQKGSIVNRFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHPGTH
    Newman          MTSKHQQKGSIVNRFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHPGTH
    USA300_FPR3757  MTSKHQQKGSIVNRFLNSVEKIGNKLPDPSVLFFLMCVGLAIMTWVISLFNVSVKHPGTH
                    ************************************************************

    COL             QTIYIKNIISHDGFTMIMNDTIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNR
    N315            QTIYIKNIISHDGFTMIMNDTIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNR
    NCTC8325        QTIYIKNIISHDGFTMIMNDTIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNR
    Newman          QTIYIKNIISHDGFTMIMNDTIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNR
    USA300_FPR3757  QTIYIKNIISHDGFTMIMNDTIKNFSEFPALGLVLAVMIGIGVAEKTGYFDKLMISVVNR
                    ************************************************************

    COL             APRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIGYHPIAGLTMAYASAVGGFAA
    N315            APRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIGYHPIAGLTMAYASAVGGFAA
    NCTC8325        APRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIGYHPIAGLTMAYASAVGGFAA
    Newman          APRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIGYHPIAGLTMAYASAVGGFAA
    USA300_FPR3757  APRFLILPTIILIGILGSTAGDAATIILPPLAAMLFIKIGYHPIAGLTMAYASAVGGFAA
                    ************************************************************

    COL             NIVVGMQDALVYSFTEPATRIVSDSIKTNVAMNWYFIAASVVVLLPTILLVTTKLIIPRL
    N315            NIVVGMQDALVYSFTEPATRIVSDSIKTNVAMNWYFIAASVVVLLPTILLVTTKLIIPRL
    NCTC8325        NIVVGMQDALVYSFTEPATRIVSDSIKTNVAMNWYFIAASVVVLLPTILLVTTKLIIPRL
    Newman          NIVVGMQDALVYSFTEPATRIVSDSIKTNVAMNWYFIAASVVVLLPTILLVTTKLIIPRL
    USA300_FPR3757  NIVVGMQDALVYSFTEPATRIVSDSIKTNVAMNWYFIAASVVVLLPTILLVTTKLIIPRL
                    ************************************************************

    COL             GKYDDSLMHDDHEETSSHITDKEAHALKWANISFIVTIILLIITAIPEHSFLRNAKTGSL
    N315            GKYDDSLMHDDHEEASSHITDKEAHALKWANISFIVTIILLIITAIPEHSFLRNAKTGSL
    NCTC8325        GKYDDSLMHDDHEETSSHITDKEAHALKWANISFIVTIILLIITAIPEHSFLRNAKTGSL
    Newman          GKYDDSLMHDDHEETSSHITDKEAHALKWANISFIVTIILLIITAIPEHSFLRNAKTGSL
    USA300_FPR3757  GKYDDSLMHDDHEETSSHITDKEAHALKWANISFIVTIILLIITAIPEHSFLRNAKTGSL
                    **************:*********************************************

    COL             LDDAPLINGVGLIILVVFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAA
    N315            LDDAPLINGVGLIILVVFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAA
    NCTC8325        LDDAPLINGVGLIILVVFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAA
    Newman          LDDAPLINGVGLIILVVFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAA
    USA300_FPR3757  LDDAPLINGVGLIILVVFLVPGLVYGILSKEIKNTKDLGKMFGDAVGSMGTFIVIVFFAA
                    ************************************************************

    COL             QLLAYLKWSNLGIIAAVKGAKLLEHQNGIVLILGIIVLSAMVNMLIGSASAKWGILGPIF
    N315            QLLAYLKWSNLGIIAAVKGAKLLEHQNGIVLILGIIVLSAMVNMLIGSASAKWGILGPIF
    NCTC8325        QLLAYLKWSNLGIIAAVKGAKLLEHQNGIVLILGIIVLSAMVNMLIGSASAKWGILGPIF
    Newman          QLLAYLKWSNLGIIAAVKGAKLLEHQNGIVLILGIIVLSAMVNMLIGSASAKWGILGPIF
    USA300_FPR3757  QLLAYLKWSNLGIIAAVKGAKLLEHQNGIVLILGIIVLSAMVNMLIGSASAKWGILGPIF
                    ************************************************************

    COL             VPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGALLSSLMP
    N315            VPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGALLSSLMP
    NCTC8325        VPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGALLSSLMP
    Newman          VPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGALLSSLMP
    USA300_FPR3757  VPMLILIGFHPAFTQVIYRVGDSITNPITPMMPYLPLLLTYAQKYDKRMKLGALLSSLMP
                    ************************************************************

    COL             YSIALSIVWTVFVIIWFLLGIPVGPGGPIFVK
    N315            YSIALSIVWTVFVIIWFLLGIPVGPGGPIFVK
    NCTC8325        YSIALSIVWTVFVIIWFLLGIPVGPGGPIFVK
    Newman          YSIALSIVWTVFVIIWFLLGIPVGPGGPIFVK
    USA300_FPR3757  YSIALSIVWTVFVIIWFLLGIPVGPGGPIFVK
                    ********************************