From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006071000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • pseudogene
  • strand?: -
  • coordinates?: 6116259..6117533
  • synteny block?: BlockID0048120
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2421
    08BA02176:
    C248_2542
    11819-97:
    71193:
    ST398NM01_2541
    ECT-R 2:
    ECTR2_2341
    ED133:
    SAOV_2531c
    ED98:
    SAAV_2550
    HO 5096 0412:
    SAEMRSA15_23840
    JH1:
    SaurJH1_2563
    JH9:
    SaurJH9_2511
    JKD6008:
    JKD6159:
    SAA6159_02380
    LGA251:
    M013:
    M013TW_2445
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2468
    Mu50:
    SAV2484
    MW2:
    RF122:
    SAB2367c
    ST398:
    SAPIG2541
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2476
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQTEYQIKSGNIKGNSEETSTVSNISYEIENANNSGLKQNKIDKQIKKLQEKNKFPKNL
    N315            MNKTKYQINSDNIKSNSEETSAISSISYEIENANNNDLNNASIQTQIEILKSQNSFPKNL
    Newman          MSQTEYQIKSGNIKGNSEETSTVSNISYEIENANNSGLKQNKIDKQIKKLQEKNKFPKNL
                    *.:*:***:*.***.******::*.**********..*:: .*:.**: *:.:*.*****

    COL             SYLKSYTDPKTGTTTSAFLNKDTGKVTLGMTGTNVHKDAILKQTFGVPSYQGYIDVSETL
    N315            SYLKSYTDPKTGTTTSAFLNKDTGKVTLGMTGTNVHKDAILKQTFGVPSYQGYIDASETL
    Newman          SYLKSYTDPKTGTTTSAFLNKDTGKVTLGMTGTNVHKDAILKQTFGVPSYQGYIDVSETL
                    *******************************************************.****

    COL             KDIGADVNIGLHSVTDKDPHYKNTQDFIKNIKKDYDIDIITGHSLGGRDAMILGMSNDIK
    N315            KDIGADVNIGLHSVTDKDPHYKNTQDFIKNIKKDYDIDIITGHSLGGRDAMILGMSNDIK
    Newman          KDIGADVNIGLHSVTDKDPHYKNTQDFIKNIKKDYDIDIITGHSLGGRDAMILGMSNDIK
                    ************************************************************

    COL             HIVVYNPAPLAIKDVSGLYADQEELKKLIEKYDGHIVRFVSDEDELDAGVRNHLYETAGE
    N315            HIVVYNPAPLAIKDVSGLYADQEELKKLIEKYDGHIVRFVSDEDELDAGVRNHLYETAGE
    Newman          HIVVYNPAPLAIKDVSGLYADQEELKKLIEKYDGHIVRFVSDEDELDAGVRNHLYETAGE
                    ************************************************************

    COL             KIVLKNGEGHAMSGILMSRTQAIILAELNKVKGYQDENNKALKSVRKQTRHRLHKVETLR
    N315            KIVLKNGEGHAMSGILMSRTQAIILAELNKVKGYQDENNKALKSVRKQTRHRLHKVETLR
    Newman          KIVLKNGEGHAMSGILMSRTQAIILAELNKVKGYQDENNKALKSVRKQTRHRLHKVETLR
                    ************************************************************

    COL             ANWIQTTGGSLSSSQQQLLEALTALTIAEGLNQLVNEESQHLKKCITRWHINLETTGKKR
    N315            ANWIQTTGGSLSSSQQQLLEALTALTIAEGLNQLVNEESQHLKK---MYHAMAHKFGDNW
    Newman          ANWIQTTGGSLSSSQQQLLEALTALTIAEGLNQLVNEESQHLKKCITRWHINLETTGKKR
                    ********************************************    :*   .. *.: 

    COL             KKLE--------------------------------------------------------
    N315            KKAQEVGNEIGEKLTSEEVIDELRKGGAYESKLETDPKRKIDDKIKKLNDVYKNCNGYIA
    Newman          KKLE--------------------------------------------------------
                    ** :                                                        

    COL             ------MKLVKN------------
    N315            KIKQSIEAIVSNDQMLASQIDGMM
    Newman          ------MKLVKN------------
                            :*.*