From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006091000
  • symbol?: pgcA
  • description?: phosphoglucomutase

      descriptions from strain specific annotations:

    • phosphoglucomutase
    • phosphoglucomutase/phosphomannomutase family protein
    • phosphoglucomutase/phosphomannomutase
    • Phosphoglucosamine mutase / Phosphomannomutase
    • bifunctional phosphoglucomutase/phosphomannomutase
    • phosphoglucomutase/phosphomannomutase, C-terminal domain protein
    • phosphoglucomutase/phosphomannomutase alpha/beta/subunit
    • phosphomannomutase
    • putative phosphomannomutase
  • strand?: +
  • coordinates?: 6144303..6146140
  • synteny block?: BlockID0048280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2427
    08BA02176:
    C248_2548
    11819-97:
    MS7_2497 (pgcA)
    71193:
    ST398NM01_2547
    ECT-R 2:
    ECTR2_2347
    ED133:
    SAOV_2537
    ED98:
    SAAV_2558
    HO 5096 0412:
    SAEMRSA15_23900
    JH1:
    SaurJH1_2569
    JH9:
    SaurJH9_2517
    JKD6008:
    SAA6008_02527 (manB)
    JKD6159:
    SAA6159_02385 (manB)
    LGA251:
    SARLGA251_22720
    M013:
    M013TW_2456
    MRSA252:
    SAR2576
    MSHR1132:
    SAMSHR1132_23120
    MSSA476:
    SAS2378
    Mu3:
    SAHV_2475
    Mu50:
    SAV2491
    MW2:
    MW2411
    RF122:
    SAB2371
    ST398:
    SAPIG2547
    T0131:
    SAT0131_02687
    TCH60:
    HMPREF0772_10700 (pgm)
    TW20:
    SATW20_26120
    USA300_TCH1516:
    USA300HOU_2482
    VC40:
    SAVC_11330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHFHTHLLYNTCEKYCLGAVFFYFWGVFLYNSLHKCKGFSFHVLLSLTEILKGCLATMDK
    N315            -------------------MFFYFWGVFLYNSLHKCKGFSFHVLLSLTEILKGCLATMDK
    NCTC8325        MHFHTHLLYNTCEKYCLGAVFFYFWGVFLYNSLHKCKGFSFHVLLSLTEILKGCLATMDK
    Newman          -------------------MFFYFWGVFLYNSLHKCKGFSFHVLLSLTEILKGCLATMDK
    USA300_FPR3757  MHFHTHLLYNTCEKYCLGAVFFYFWGVFLYNSLHKCKGFSFHVLLSLTEILKGCLATMDK
                                       :****************************************

    COL             ELWIERANDSLVKHFYEQQSDIEQREGFESKLTFGTAGIRGKFGLGEGRLNKFTIEKLAL
    N315            ELWIERANDSLVKHFYEQQSDIEQREGFESKLTFGTAGIRGKFGLGEGRLNKFTIEKLAL
    NCTC8325        ELWIERANDSLVKHFYEQQSDIEQREGFESKLTFGTAGIRGKFGLGEGRLNKFTIEKLAL
    Newman          ELWIERANDSLVKHFYEQQSDIEQREGFESKLTFGTAGIRGKFGLGEGRLNKFTIEKLAL
    USA300_FPR3757  ELWIERANDSLVKHFYEQQSDIEQREGFESKLTFGTAGIRGKFGLGEGRLNKFTIEKLAL
                    ************************************************************

    COL             GLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYLPDTYKTTPELSFAVR
    N315            GLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYLPDTYKTTPELSFAVR
    NCTC8325        GLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYLPDTYKTTPELSFAVR
    Newman          GLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYLPDTYKTTPELSFAVR
    USA300_FPR3757  GLARYLNAQTNSPTIVIHYDIRHLSTEFAQIIANVLANHQITVYLPDTYKTTPELSFAVR
                    ************************************************************

    COL             NLNTTAGIMITASHNPKDYNGIKVYGSDGAQLSTDASELASRYIEEVGDPLQIDIPISKQ
    N315            NLNTTAGIMITASHNPKDYNGIKVYGSDGAQLSTDASELASRYIEEVGDPLQIDIPISKQ
    NCTC8325        NLNTTAGIMITASHNPKDYNGIKVYGSDGAQLSTDASELASRYIEEVGDPLQIDIPISKQ
    Newman          NLNTTAGIMITASHNPKDYNGIKVYGSDGAQLSTDASELASRYIEEVGDPLQIDIPISKQ
    USA300_FPR3757  NLNTTAGIMITASHNPKDYNGIKVYGSDGAQLSTDASELASRYIEEVGDPLQIDIPISKQ
                    ************************************************************

    COL             NTSYIKPFPKSVTDDYMKHIQNMIGYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFN
    N315            NTSYIKPFPKSVTDDYMKHIQNMIGYIPKSDLQVVFTSLHGTSVPIVPELLKSLNFNQFN
    NCTC8325        NTSYIKPFPKSVTDDYMKHIQNMIGYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFN
    Newman          NTSYIKPFPKSVTDDYMKHIQNMIGYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFN
    USA300_FPR3757  NTSYIKPFPKSVTDDYMKHIQNMIGYIPKSDLQVVFTSLHGTSVPIVPELLQSLNFNQFN
                    ***************************************************:********

    COL             LVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHG
    N315            LVDAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHG
    NCTC8325        LVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHG
    Newman          LVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHG
    USA300_FPR3757  LVEAQCKPDPNFSSVQSANPEDHRAFDQAVELANKSHADLLISTDPDADRLGIAERDAHG
                    **:*********************************************************

    COL             HITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKF
    N315            HITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVKYKEVLTGFKF
    NCTC8325        HITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKF
    Newman          HITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKF
    USA300_FPR3757  HITYFNGNQIGALLLNYRIQQTSQLRHRLMIQSIVSSELTKSLARYNNVEYKEVLTGFKF
                    *************************************************:**********

    COL             IAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDEL
    N315            IAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDEL
    NCTC8325        IAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDEL
    Newman          IAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDEL
    USA300_FPR3757  IAQEIRQLDDHQNMIFAFEESYGFLSEPFVRDKDAVQIVPLIIKYASELKLYGKTLKDEL
                    ************************************************************

    COL             EQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVY
    N315            EQIYQTVGRHEDTLFSHTLEGLEGKKKIESIMTHFRSNPPQEIQGLKVKAIEDYLTSEVY
    NCTC8325        EQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVY
    Newman          EQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVY
    USA300_FPR3757  EQIYQTVGRHEDTLFSHTLEGFEGKKKINAIMTKFRSNPPQEIQGLKVKAIEDYLTSEVY
                    *********************:******::***:**************************

    COL             HLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSLKCPNFDDVAQKINAMI
    N315            HLDKDTTSQINSSKSNVIRVLFDEGFIALRPSGTEPKIKLYVSLKCPDFDDVAQKINAMI
    NCTC8325        HLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSLKCPNFDDVAQKINAMI
    Newman          HLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSLKCPNFDDVAQKINAMI
    USA300_FPR3757  HLDKDTTSQINSPKSNVIRVLFDEGFIALRPSGTEPKIKLYVSLKCPNFDDVAQKINAMI
                    ************.**********************************:************

    COL             FS
    N315            FS
    NCTC8325        FS
    Newman          FS
    USA300_FPR3757  FS
                    **