From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006093000
  • symbol?:
  • description?: probable membrane protein
  • strand?: +
  • coordinates?: 6146837..6147145
  • synteny block?: BlockID0048300
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2429
    08BA02176:
    C248_2550
    11819-97:
    MS7_2498
    71193:
    ST398NM01_2548
    ECT-R 2:
    ECTR2_2348
    ED133:
    SAOV_2539
    ED98:
    SAAV_2560
    HO 5096 0412:
    SAEMRSA15_23920
    JH1:
    SaurJH1_2571
    JH9:
    SaurJH9_2519
    JKD6008:
    SAA6008_02529
    JKD6159:
    SAA6159_02387
    LGA251:
    SARLGA251_22740
    M013:
    MRSA252:
    SAR2578
    MSHR1132:
    SAMSHR1132_23140
    MSSA476:
    SAS2380
    Mu3:
    SAHV_2477
    Mu50:
    SAV2493
    MW2:
    MW2413
    RF122:
    SAB2373
    ST398:
    SAPIG2548
    T0131:
    SAT0131_02689
    TCH60:
    HMPREF0772_10698
    TW20:
    SATW20_26140
    USA300_TCH1516:
    USA300HOU_2484
    VC40:
    SAVC_11340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVNIVFSIVFCISMVILGIYVAITKDFTLISFINQTAIADKHKNQIAYIFTLCISLSAV
    N315            MTVNIVFSIVFCISMVILGIYVAITKDFTLISYINQTTIADKHKNQIAYIFTLCISLSAV
    NCTC8325        MTVNIVFSIVFCISMVILGIYVAITKDFTLISFINQTAIADKHKNQIAYIFTLCISLSAV
    Newman          MTVNIVFSIVFCISMVILGIYVAITKDFTLISFINQTAIADKHKNQIAYIFTLCISLSAV
                    ********************************:****:**********************

    COL             FLMSSILSFEYDFIALAFLFLTIALLLIALFYVCFYKITKYP
    N315            FLMSSILCFEYDFIALSFLFLTIALLLIALFYVCFYKITKYP
    NCTC8325        FLMSSILSFEYDFIALAFLFLTIALLLIALFYVCFYKITKYP
    Newman          FLMSSILSFEYDFIALAFLFLTIALLLIALFYVCFYKITKYP
                    *******.********:*************************