From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006098000
  • symbol?: fnbA
  • description?: fibronectin-binding protein precursor

      descriptions from strain specific annotations:

    • fibronectin-binding protein precursor
    • fibronectin-binding protein A
    • fibronectin-binding protein FnbA
    • fibronectin binding protein A precursor
    • fibronectin-binding protein A, FnbA
    • cell wall anchor domain-containing protein
    • gram positive anchor domain protein
  • strand?: -
  • coordinates?: 6148339..6204317
  • synteny block?: BlockID0048350
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2511 (fnbA)
    N315:
    SA2291 (fnb)
    NCTC8325:
    Newman:
    NWMN_2399 (fnbA)
    USA300_FPR3757:
    04-02981:
    SA2981_2439 (fnbA)
    08BA02176:
    C248_2555 (fnbA)
    11819-97:
    MS7_2506
    71193:
    ST398NM01_2553
    ECT-R 2:
    ECTR2_2355
    ED133:
    SAOV_2545c (fnbA)
    ED98:
    SAAV_2568 (fnbA)
    HO 5096 0412:
    SAEMRSA15_23990 (fnbA)
    JH1:
    SaurJH1_2578
    JH9:
    SaurJH9_2526
    JKD6008:
    SAA6008_02538
    JKD6159:
    SAA6159_02398 (fnbA)
    LGA251:
    SARLGA251_22770 (fnbA)
    M013:
    MRSA252:
    SAR2580 (fnbA)
    MSHR1132:
    SAMSHR1132_23220
    MSSA476:
    SAS2388
    Mu3:
    SAHV_2487 (fnb)
    Mu50:
    SAV2503 (fnb)
    MW2:
    MW2421 (fnb)
    RF122:
    SAB2375c (fnbA)
    ST398:
    SAPIG2553
    T0131:
    SAT0131_02701 (truB)
    TCH60:
    HMPREF0772_10694 (fnbA)
    TW20:
    SATW20_26230 (fnbA)
    USA300_TCH1516:
    USA300HOU_2491 (fnbA)
    VC40:
    SAVC_11380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSET
    N315            MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSET
    NCTC8325        ----------------------------MGQDKEAAASEQKTTTVEENGNSATDNKTSET
    Newman          MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSET
    USA300_FPR3757  MKNNLRYGIRKHKLGAASVFLGTMIVVGMGQDKEAAASEQKTTTVEENGNSATDNKTSET
                                                ********************************

    COL             QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKE
    N315            QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANVET-----VKE
    NCTC8325        QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKE
    Newman          QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKE
    USA300_FPR3757  QTTATNVNHIEETQSYNATVTEQPSNATQVTTEEAPKAVQAPQTAQPANIETVKEEVVKE
                    *************************************************:**     ***

    COL             EAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADV
    N315            EEKPQVKETTQPQDNSGNQRQVDLTPKKVTQNQGTETQVEVAQPRTASESKPRVTRSADV
    NCTC8325        EAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADV
    Newman          EAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADV
    USA300_FPR3757  EAKPQVKETTQSQDNSGDQRQVDLTPKKATQNQVAETQVEVAQPRTASESKPRVTRSADV
                    * *********.*****:**********.**** :*************************

    COL             AEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQG
    N315            AEAKEASDVSEVKGTDVTSKVTVESGSIEAPQG-NKVEPHAGQRVVLKYKLKFADGLKRG
    NCTC8325        AEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQG
    Newman          AEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQG
    USA300_FPR3757  AEAKEASNAKVETGTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQG
                    *******:..  .*********** ****. :. **********.******** :**::*

    COL             DYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAE
    N315            DYFDFTLSNNVNTYGVSTARKVPEIKNGSVVMATGEILGNGNIRYTFTNEIEHKVEVTAN
    NCTC8325        DYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAE
    Newman          DYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAE
    USA300_FPR3757  DYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAE
                    *************:**********************:* .*:*******:**.**:***:

    COL             LEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANN
    N315            LEINLFIDPKTVQSNGEQKITSKLNGEETEKTIPVVYNPGVSNSYTNVNGSIETFNKESN
    NCTC8325        LEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANN
    Newman          LEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANN
    USA300_FPR3757  LEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANN
                    *************:**:*.***.** *:*.* : * *: *:.* *:*:********* .*

    COL             RFSHVAFIKPNNG-KTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTD
    N315            KFTHIAYIKPMNGNQSNTVSVTGTLTEGSNLAGGQPTVKVYEYLGKKDELPQSVYANTSD
    NCTC8325        RFSHVAFIKPNNG-KTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTD
    Newman          RFSHVAFIKPNNG-KTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTD
    USA300_FPR3757  RFSHVAFIKPNNG-KTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTD
                    :*:*:*:*** ** ::.:*:***** :***  *.**.*:::****:::::.:******:*

    COL             TSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPE
    N315            TNKFKDVTKEMNGKLSVQDNGSYSLNLDKLDKTYVIHYTGEYLQGSDQVNFRTELYGYPE
    NCTC8325        TSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPE
    Newman          TSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPE
    USA300_FPR3757  TSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPE
                    *.***:**.:*.*:*.:*:*******:::******:** ****:*:*:*:***:: *:**

    COL             QLYK-YYYDRGYTLTWDNGLVLYSNKANGNGKNGPIIQNNKFEYKEDTIKETLTGQYDKN
    N315            RAYKSYYVYGGYRLTWDNGLVLYSNKADGNGKNGQIIQDNDFEYKEDTAKGTMSGQYDAK
    NCTC8325        QLYK-YYYDRGYTLTWDNGLVLYSNKANGNEKNGPIIQNNKFEYKEDTIKETLTGQYDKN
    Newman          QLYK-YYYDRGYTLTWDNGLVLYSNKANGNGKNGPIIQNNKFEYKEDTIKETLTGQYDKN
    USA300_FPR3757  QLYK-YYYDRGYTLTWDNGLVLYSNKANGNGKNGPIIQNNKFEYKEDTIKETLTGQYDKN
                    : ** **   ** **************:** *** ***:*.******* * *::**** :

    COL             LVTTVEEEYDSSTLDIDYHTAIDGGGGYVDGYIETIEETDSSAIDIDYHTAVDSEAGHVG
    N315            QIIETEENQDNTPLDIDYHTAIDGEGGYVDGYIETIEETDSSAIDIDYHTAVDSEVGHVG
    NCTC8325        LVTTVEEEYDSSTLDIDYHTAIDGGGGYVDGYIETIEETDSSAIDIDYHTAVDSEAGHVG
    Newman          LVTTVEEEYDSSTLDIDYHTAIDGGGGYVDGYIETIEETDSSAIDIDYHTAVDSEAGHVG
    USA300_FPR3757  LVTTVEEEYDSSTLDIDYHTAIDGGGGYVDGYIETIEETDSSAIDIDYHTAVDSEAGHVG
                     :  .**: *.:.*********** ******************************.****

    COL             GYTESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEESTKGIV
    N315            GYTESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEESTKGIV
    NCTC8325        GYTESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEESTKGIV
    Newman          GYTESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEDSTKGIV
    USA300_FPR3757  GYTESSEESNPIDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEESTKGIV
                    *****************************************************:******

    COL             TGAVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPVEEITENNHHISHSGLGTENG
    N315            TGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSGLGTENG
    NCTC8325        TGAVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPVEEITKNNHHISHSGLGTENG
    Newman          TGAVSDHTTIEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSGLGTENG
    USA300_FPR3757  TGAVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPVEEITENNHHISHSGLGTENG
                    *********:*****************************:****:***************

    COL             HGNYDVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDIDFDSV
    N315            HGNYGVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDIDFDSV
    NCTC8325        HGNYDVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDIDFDSV
    Newman          HGNYGVIEEIEENSHVDIKSELG-------------------------------------
    USA300_FPR3757  HGNYDVIEEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDIDFDSV
                    ****.******************                                     

    COL             PQIHGQNKGNQSFEEDTEKDKPKYEHGGNIIDIDFDSVPHIHGFNKHTEIIEEDTNKDKP
    N315            PQIHGQNKGDQSFEEDTEKDKPKYEHGGNIIDIDFDSVPQIHGFNKHNEIIEEDTNKDKP
    NCTC8325        PQIHGQNKGNQSFEEDTEKDKPKYEHGGNIIDIDFDSVPHIHGFNKHTEIIEEDTNKDKP
    Newman          ------------------------------------------------------------
    USA300_FPR3757  PQIHGQNKGNQSFEEDTEKDKPKYEHGGNIIDIDFDSVPHIHGFNKHTEIIEEDTNKDKP
                                                                                

    COL             SYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPIVP--------------------
    N315            NYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPTPPTPEVPSEPETPMPPTPEVPS
    NCTC8325        SYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPIVP--------------------
    Newman          ------------------------------------------------------------
    USA300_FPR3757  SYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPIVP--------------------
                                                                                

    COL             ----PTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPAEPGK
    N315            EPETPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPAEPGK
    NCTC8325        ----PTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPAEPGK
    Newman          ------------------------------------------------------------
    USA300_FPR3757  ----PTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPAEPGK
                                                                                

    COL             PVPPAKEEPKKPSKPVEQGKVVTPVIEINEKVKAVAPTKKPQSKKSELPETGGEESTNKG
    N315            PVPPAKEEPKKPSKPVEQGKVVTPVIEINEKVKAVAPTKKAQSKKSELPETGGEESTNKG
    NCTC8325        PVPPAKEEPKKPSKPVEQGKVVTPVIEINEKVKAVAPTKKPQSKKSELPETGGEESTNKG
    Newman          ------------------------------------------------------------
    USA300_FPR3757  PVPPAKEEPKKPSKPVEQGKVVTPVIEINEKVKAVAPTKKPQSKKSELPETGGEESTNKG
                                                                                

    COL             MLFGGLFSILGLALLRRNKKNHKA
    N315            MLFGGLFSILGLALLRRNKKNNKA
    NCTC8325        MLFGGLFSILGLALLRRNKKNHKA
    Newman          ------------------------
    USA300_FPR3757  MLFGGLFSILGLALLRRNKKNHKA