From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN006111000
  • symbol?: sasG
  • description?: putative cell wall surface anchor family protein

      descriptions from strain specific annotations:

    • putative cell wall surface anchor family protein
    • accumulation-associated protein (truncated)
    • Virulence-associated cell-wall-anchored protein SasG (LPXTG motif), binding to squamous nasal epithelial cells
  • strand?: -
  • coordinates?: 6171429..6188925
  • synteny block?: BlockID0048450
  • occurrence?: in 13% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2433 (sasG)
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    SAV2497
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MRDKKGPVNKRVDFLSNKLNKYSIRKFTVGTASILIGSLMYLGTQQEAEAAENNIENPTT
    USA300_FPR3757  MRDKKGPVNKRVDFLSNKLNKYSIRKFTVGTASILIGSLMYLGTQQEAEAAENNIENPTT
                    ************************************************************

    N315            LKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEASVKAEDISKKEDTPKEVA
    USA300_FPR3757  LKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEPSVKAEDISKKEDTPKEVA
                    *****************************************.******************

    N315            NVAEVQPKSSVTHNAEAPKVRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSV
    USA300_FPR3757  DVAEVQPKSSVTHNAETPKVRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSV
                    :***************:*******************************************

    N315            DIQKNPTDLGVSEVTRFNVGNESNGLIGALQLKNKIDFSKDFNFKVRVANNHQSNTTGAD
    USA300_FPR3757  DIQKKPTDLGVSEVTRFNVGNESNGLIGALQLKNKIDFSKDFNFKVRVANNHQSNTTGAD
                    ****:*******************************************************

    N315            GWGFLFSKGNAEEYLTNGGILGDKGLVNSGGFKIDTGYIYTSSMDKTEKQAGQGYRGYGA
    USA300_FPR3757  GWGFLFSKGNAEEYLTNGGILGDKGLVNSGGFKIDTGYIYTSSMDKTEKQAGQGYRGYGA
                    ************************************************************

    N315            FVKNDSSGNSQMVGENIDKSKTNFLNYADNSTNTSDGKFHGQRLNDVILTYVASTGKMRA
    USA300_FPR3757  FVKNDSSGNSQMVGENIDKSKTNFLNYADNSTNTSDGKFHGQRLNDVILTYVASTGKMRA
                    ************************************************************

    N315            EYAGKTWETSITDLGLSKNQAYNFLITSSQRWGLNQGINANGWMRTDLKGSEFTFTPEAP
    USA300_FPR3757  EYAGKTWETSITDLGLSKNQAYNFLITSSQRWGLNQGINANGWMRTDLKGSEFTFTPEAP
                    ************************************************************

    N315            KTITELEKKLKRFHSRKNVNLIRI
    USA300_FPR3757  KTITELEKKLKRFHSRKNVNLIRI
                    ************************