From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006131000
  • symbol?: gntK
  • description?: gluconokinase

      descriptions from strain specific annotations:

    • gluconokinase
    • gluconate kinase
    • putative gluconokinase
  • strand?: -
  • coordinates?: 6206348..6207901
  • synteny block?: BlockID0048630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2515 (gntK)
    N315:
    SA2294 (gntK)
    NCTC8325:
    Newman:
    NWMN_2402 (gntK)
    USA300_FPR3757:
    04-02981:
    SA2981_2442 (gntK)
    08BA02176:
    C248_2558 (gntK)
    11819-97:
    MS7_2509 (gntK)
    71193:
    ST398NM01_2556
    ECT-R 2:
    ECTR2_2358 (gntK)
    ED133:
    SAOV_2547c
    ED98:
    SAAV_2571 (gntK)
    HO 5096 0412:
    SAEMRSA15_24020 (gntK)
    JH1:
    SaurJH1_2581
    JH9:
    SaurJH9_2529
    JKD6008:
    SAA6008_02541 (gntK)
    JKD6159:
    SAA6159_02400 (gntK)
    LGA251:
    SARLGA251_22790 (gntK)
    M013:
    M013TW_2471
    MRSA252:
    SAR2583 (gntK)
    MSHR1132:
    SAMSHR1132_23240
    MSSA476:
    SAS2391
    Mu3:
    SAHV_2490 (gntK)
    Mu50:
    SAV2506 (gntK)
    MW2:
    MW2424 (gntK)
    RF122:
    SAB2378c (gntK)
    ST398:
    SAPIG2556 (gntK)
    T0131:
    SAT0131_02704
    TCH60:
    HMPREF0772_10691 (gntK)
    TW20:
    SATW20_26250 (gntK)
    USA300_TCH1516:
    USA300HOU_2493 (gntK)
    VC40:
    SAVC_11395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKY
    N315            MKYMIGVDIGTTSTKSVLYDENGAFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKY
    NCTC8325        MKYMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKY
    Newman          MKYMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKY
    USA300_FPR3757  MKYMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKY
                    ***********************:************************************

    COL             VMRESKVNKDDIKFVSFSAQMHSLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNA
    N315            IMRESKVNQDDIKFVSFSAQMHSLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNA
    NCTC8325        VMRESKVNKDDIKFVSFSAQMHSLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNA
    Newman          VMRESKVNKDDIKFVSFSAQMHSLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNA
    USA300_FPR3757  VMRESKVNKDDIKFVSFSAQMHSLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNA
                    :*******:***************************************************

    COL             IYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYIFYHLFDTYIIDYSMASAT
    N315            IYQRTGTPIHPMSPLVKIFWMKHEWQDVFQRTAKFADIKTYIFYHLFDTYIIDYSMASAT
    NCTC8325        IYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYIFYHLFDTYIIDYSMASAT
    Newman          IYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYIFYHLFDTYIIDYSMASAT
    USA300_FPR3757  IYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYIFYHLFDTYIIDYSMASAT
                    ***************.********************************************

    COL             GMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASD
    N315            GMFNLETLDWDVGALELLGISKEMFPELVPTTYVMKGMKERYATLMGLNEDTPFVIGASD
    NCTC8325        GMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASD
    Newman          GMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASD
    USA300_FPR3757  GMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASD
                    ************ ***********:************************:**********

    COL             GVLSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNG
    N315            GVLSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNG
    NCTC8325        GVLSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNG
    Newman          GVLSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNG
    USA300_FPR3757  GVLSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNG
                    ************************************************************

    COL             GVVLRWLRDELLASEVETAKRLGVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNA
    N315            GVVLRWLRDELLASEVETAKRLGVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNA
    NCTC8325        GVVLRWLRDELLASEVETAKRLGVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNA
    Newman          GVVLRWLRDELLASEVETAKRLGVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNA
    USA300_FPR3757  GVVLRWLRDELLASEVETAKRLGVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNA
                    ************************************************************

    COL             NARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMNETPKMIKATGGFAKSEVW
    N315            NARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMNETPNMIKATGGFAKSEVW
    NCTC8325        NARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMNETPKMIKATGGFAKSEVW
    Newman          NARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMNETPKMIKATGGFAKSEVW
    USA300_FPR3757  NARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMNETPKMIKATGGFAKSEVW
                    *********************************************:**************

    COL             RQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVT
    N315            RQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPFEENVA
    NCTC8325        RQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVT
    Newman          RQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVT
    USA300_FPR3757  RQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVT
                    ******************************************************:****:

    COL             VYQEIVSIFINLSRSLTENYEQIADFQRQHIAENKTQ
    N315            VYQELVSIFINLSRSLTENYEQIADFQRQHMAENKTQ
    NCTC8325        VYQEIVSIFINLSRSLTENYEQIADFQRQHIAENKTQ
    Newman          VYQEIVSIFINLSRSLTENYEQIADFQRQHIAENKTQ
    USA300_FPR3757  VYQEIVSIFINLSRSLTENYEQIADFQRQHIAENKTQ
                    ****:*************************:******