From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006139000
  • symbol?:
  • description?: FUSC family protein

      descriptions from strain specific annotations:

    • FUSC family protein
    • fusaric acid resistance family protein
    • integral membrane protein
    • membrane protein
  • strand?: -
  • coordinates?: 6211311..6212979
  • synteny block?: BlockID0048700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2447
    08BA02176:
    C248_2563
    11819-97:
    MS7_2514
    71193:
    ST398NM01_2561
    ECT-R 2:
    ECTR2_2363
    ED133:
    SAOV_2553c
    ED98:
    SAAV_2576
    HO 5096 0412:
    SAEMRSA15_24070
    JH1:
    SaurJH1_2586
    JH9:
    SaurJH9_2534
    JKD6008:
    SAA6008_02546
    JKD6159:
    SAA6159_02405
    LGA251:
    SARLGA251_22840
    M013:
    M013TW_2476
    MRSA252:
    SAR2588
    MSHR1132:
    SAMSHR1132_23290
    MSSA476:
    SAS2396
    Mu3:
    SAHV_2495
    Mu50:
    SAV2511
    MW2:
    MW2429
    RF122:
    SAB2383c
    ST398:
    SAPIG2561
    T0131:
    SAT0131_02710
    TCH60:
    HMPREF0772_10686
    TW20:
    SATW20_26300
    USA300_TCH1516:
    USA300HOU_2498
    VC40:
    SAVC_11420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSLIKINRLNLDFYKGVRQGLLMIIPAIIGYLCGNFQFGLLVATGTLAHIYVFKGPSRS
    N315            -----------------------MIIPAIIGYLCGNFQFGLLVATGTLAHIYVFKGPSRS
    NCTC8325        MTSLIKINRLNLDFYKGVRQGLLMIIPAIIGYLCGNFQFGLLVATGTLAHIYVFKGPSRS
    Newman          MTSLIKINRLNLDFYKGVRQGLLMIIPAIIGYLCGNFQFGLLVATGTLAHIYVFKGPSRS
    USA300_FPR3757  MTSLIKINRLNLDFYKGVRQGLLMIIPAIIGYLCGNFQFGLLVATGTLAHIYVFKGPSRS
                                           *************************************

    COL             KLRTVIICNLAFAICMMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVT
    N315            KLRTVIICNLAFAICMMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVT
    NCTC8325        KLRTVIICNLAFAICMMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVT
    Newman          KLRTVIICNLAFAICMMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVT
    USA300_FPR3757  KLRTVIICNLAFAICMMLGTLTAKTPLVFGMTLLIVTVIPFYIFTALKIAGPSSTFFIVT
                    ************************************************************

    COL             FSLPINLPIAPEEALYRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLH
    N315            FSLPINLPIAPEEALYRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLH
    NCTC8325        FSLPINLPIAPEEALYRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLH
    Newman          FSLPINLPIAPEEALYRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLH
    USA300_FPR3757  FSLPINLPIAPEEALYRGFAILVGGILATMMVLITIVFSKNKAEEQAIQNDFKLISKLLH
                    ************************************************************

    COL             TYNDKSAFLQVAKTAVDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLEL
    N315            TYNDKAAFLQVAKTAVDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLEL
    NCTC8325        TYNDKSAFLQVAKTAVDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLEL
    Newman          TYNDKSAFLQVAKTAVDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLEL
    USA300_FPR3757  TYNDKSAFLQVAKTAVDSFKASDKLLITSTSSNDKLSRRFQKLLLLHTSAQGIYSELLEL
                    *****:******************************************************

    COL             NAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWRKEVTVTEEFQNLFNHILKIDEMVHAN
    N315            NAKQIRPLPDELIEMMDHIIAQLDNSDENVRYWRKEVTVTEEFQNLFNHILKIDEMVHAN
    NCTC8325        NAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWRKEVTVTEEFQNLFNHILKIDEMVHAN
    Newman          NAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWRKEVTVTEEFQNLFNHILKIDEMVHAN
    USA300_FPR3757  NAKQIRPLPDELIEMMDHIIAQLDNSEENVRYWRKEVTVTEEFQNLFNHILKIDEMVHAN
                    **************************:*********************************

    COL             EARIAYEADMRKPLYSKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPL
    N315            EARIAYEADMRKPLYSKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPL
    NCTC8325        EARIAYEADMRKPLYSKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPL
    Newman          EARIAYEADMRKPLYSKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPL
    USA300_FPR3757  EARIAYEADMRKPLYSKRIYQNLTLDSIVFRNTLRYTAIMMIAIFIALMFDFEKAYWIPL
                    ************************************************************

    COL             SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALV
    N315            SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALV
    NCTC8325        SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALV
    Newman          SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALV
    USA300_FPR3757  SAHTILLGTSTIHAIERGMARGLGTILGVLVLSVILLFSIPTPVAVILMGIAALFTEALV
                    ************************************************************

    COL             GANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIAIIGLFVLGQRTASAL
    N315            GANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAIGIVIAIIGLFVLGQRTASVL
    NCTC8325        GANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIAIIGLFVLGQRTASAL
    Newman          GANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIAIIGLFVLGQRTASAL
    USA300_FPR3757  GANYAIAVVFITIQVILMNGLASQNLTINIAFPRVIDVAMGIVIAIIGLFVLGQRTASAL
                    ***************************************:******************.*

    COL             LPNVMAEVVRKEATLFHYLFSENQYKDDVYQKNTAMNLSVKLNNMTQVYNAANGELFSDK
    N315            LPNVMAEVVRKEATLFHYLFSENQYKDNVYQKNTAMNLSVKLNNMTQVYNAANGELFSDK
    NCTC8325        LPNVMAEVVRKEATLFHYLFSENQYKDDVYQKNTAMNLSVKLNNMTQVYNAANGELFSDK
    Newman          LPNVMAEVVRKEATLFHYLFSENQYKDDVYQKNTAMNLSVKLNNMTQVYNAANGELFSDK
    USA300_FPR3757  LPNVMAEVVRKEATLFHYLFSENQYKDDVYQKNTAMNLSVKLNNMTQVYNAANGELFSDK
                    ***************************:********************************

    COL             TLIQNYYPSLFALEEISFMLNRAMANEDRLTINEQLMGEYLAIFENIAKHFELNTELEIK
    N315            TLIQNYYPSLFALEEISFMLNRAMANEDRLTINEQLMGEYLATFENIAKHLELNTELEIK
    NCTC8325        TLIQNYYPSLFALEEISFMLNRAMANEDRLTINEQLMGEYLAIFENIAKHFELNTELEIK
    Newman          TLIQNYYPSLFALEEISFMLNRAMANEDRLTINEQLMGEYLAIFENIAKHFELNTELEIK
    USA300_FPR3757  TLIQNYYPSLFALEEISFMLNRAMANEDRLTINEQLMGEYLAIFENIAKHFELNTELEIK
                    ****************************************** *******:*********

    COL             ILPDLPQYNYIQSAMMNIQHNGFRERDKNV
    N315            ILPDLPQYNYIQSAMMNIQHNGFRERDKNV
    NCTC8325        ILPDLPQYNYIQSAMMNIQHNGFRERDKNV
    Newman          ILPDLPQYNYIQSAMMNIQHNGFRERDKNV
    USA300_FPR3757  ILPDLPQYNYIQSAMMNIQHNGFRERDKNV
                    ******************************