From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006142000
  • symbol?:
  • description?: alkaline phosphatase

      descriptions from strain specific annotations:

    • alkaline phosphatase
    • DedA family protein
    • Alkaline phosphatase like protein
  • strand?: +
  • coordinates?: 6215989..6216600
  • synteny block?: BlockID0048730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2449
    08BA02176:
    C248_2566
    11819-97:
    MS7_2516
    71193:
    ST398NM01_2563
    ECT-R 2:
    ECTR2_2365
    ED133:
    SAOV_2555
    ED98:
    SAAV_2578
    HO 5096 0412:
    SAEMRSA15_24090
    JH1:
    SaurJH1_2588
    JH9:
    SaurJH9_2536
    JKD6008:
    SAA6008_02548
    JKD6159:
    SAA6159_02407
    LGA251:
    SARLGA251_22860
    M013:
    M013TW_2478
    MRSA252:
    SAR2590
    MSHR1132:
    SAMSHR1132_23320
    MSSA476:
    SAS2398
    Mu3:
    SAHV_2497
    Mu50:
    SAV2513
    MW2:
    MW2432
    RF122:
    SAB2386
    ST398:
    SAPIG2563
    T0131:
    SAT0131_02713
    TCH60:
    HMPREF0772_10684
    TW20:
    SATW20_26320
    USA300_TCH1516:
    USA300HOU_2500
    VC40:
    SAVC_11430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
    N315            MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
    NCTC8325        MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
    Newman          MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
    USA300_FPR3757  MEQIITEFISRFGYAAIFILILLENVLPIVPSEIILTFAGLMSVKSHLSILTLFIIATIA
                    ************************************************************

    COL             SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
    N315            SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLRRANDWFKKYGVWAVFICRFIP
    NCTC8325        SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
    Newman          SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
    USA300_FPR3757  SFIGLLILYYICRLISEERLYRFIDRHGKWIKLKSKDLKRANDWFKKYGVWAVFICRFIP
                    **************************************:*********************

    COL             VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
    N315            VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
    NCTC8325        VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
    Newman          VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
    USA300_FPR3757  VLRVLITIPAGVNRMNVVTFTVISLIGTTIWNFGLILLGRTLSDSFGMLMTGLHTYSRIM
                    ************************************************************

    COL             YVVIIIAVIYFAIRYIGKRKRVK
    N315            YVVIIIAVIYFAIRYIGKRKRVK
    NCTC8325        YVVIIIAVIYFAIRYIGKRKRVK
    Newman          YVVIIIAVIYFAIRYIGKRKRVK
    USA300_FPR3757  YVVIIIAVIYFAIRYIGKRKRVK
                    ***********************