From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006162000
  • symbol?:
  • description?: carboxylesterase

      descriptions from strain specific annotations:

    • carboxylesterase
    • phospholipase/carboxylesterase family protein
    • phospholipase/carboxylesterase
    • hydrolase
    • putative phospholipase/carboxylesterase
  • strand?: -
  • coordinates?: 6235085..6235678
  • synteny block?: BlockID0048870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2454
    08BA02176:
    C248_2576
    11819-97:
    MS7_2523
    71193:
    ST398NM01_2570
    ECT-R 2:
    ECTR2_2370
    ED133:
    SAOV_2562c
    ED98:
    SAAV_2583
    HO 5096 0412:
    SAEMRSA15_24160
    JH1:
    SaurJH1_2593
    JH9:
    SaurJH9_2541
    JKD6008:
    SAA6008_02556
    JKD6159:
    SAA6159_02414
    LGA251:
    SARLGA251_22930
    M013:
    M013TW_2489
    MRSA252:
    SAR2598
    MSHR1132:
    SAMSHR1132_23390
    MSSA476:
    SAS2403
    Mu3:
    SAHV_2502
    Mu50:
    SAV2518
    MW2:
    MW2438
    RF122:
    SAB2392c
    ST398:
    SAPIG2570
    T0131:
    SAT0131_02720
    TCH60:
    HMPREF0772_10675
    TW20:
    SATW20_26390
    USA300_TCH1516:
    USA300HOU_2508
    VC40:
    SAVC_11465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEHIFREGQNGAPTLILLHGTGGDEFDLLPLGEALNENYHLLSIRGQVSENGMNRYFKRL
    N315            MEHIFREGQKGAPTLILLHGTGGDEFDLLPLGEALNENYHLLSIRGQVSENGMNRYFKRL
    NCTC8325        MEHIFREGQNGAPTLILLHGTGGDEFDLLPLGEALNENYHLLSIRGQVSENGMNRYFKRL
    Newman          MEHIFREGQNGAPTLILLHGTGGDEFDLLPLGEALNENYHLLSIRGQVSENGMNRYFKRL
    USA300_FPR3757  MEHIFREGQNGAPTLILLHGTGGDEFDLLPLGEALNENYHLLSIRGQVSENGMNRYFKRL
                    *********:**************************************************

    COL             GEGVYDEEDLAFRGQELLTFIKEAAERYDFDIEKAVLVGFSNGSNIAINLMLRSEAPFKK
    N315            GEGVYDEEDLEFRGQELLAFIKEAAERYEFDIEKAVLVGFSNGSNIAINLMLRSEAPFKK
    NCTC8325        GEGVYDEEDLAFRGQELLTFIKEAAERYDFDIEKAVLVGFSNGSNIAINLMLRSEAPFKK
    Newman          GEGVYDEEDLAFRGQELLTFIKEAAERYDFDIEKAVLVGFSNGSNIAINLMLRSEAPFKK
    USA300_FPR3757  GEGVYDEEDLAFRGQELLTFIKEAAERYDFDIEKAVLVGFSNGSNIAINLMLRSEAPFKK
                    ********** *******:*********:*******************************

    COL             ALLYAPLYPVEVTSTKDLSDVSVLLSMGKHDPIVPLAASEQVINLFNTRGAQVEEVWVKG
    N315            ALLYAPLYPVEVTSTKDLSDVSVLLSMGKHDPIVPLAASEQVINLFKTRGAVVEEVWVNG
    NCTC8325        ALLYAPLYPVEVTSTKDLSDVSVLLSMGKHDPIVPLAASEQVINLFNTRGAQVEEVWVKG
    Newman          ALLYAPLYPVEVTSTKDLSDVSVLLSMGKHDPIVPLAASEQVINLFNTRGAQVEEVWVKG
    USA300_FPR3757  ALLYAPLYPVEVTSTKDLSDVSVLLSMGKHDPIVPLAASEQVINLFNTRGAQVEEVWVKG
                    **********************************************:**** ******:*

    COL             HEITETGLTAGQQILGK
    N315            HEITETGLTAGQQILGK
    NCTC8325        HEITETGLTAGQQILGK
    Newman          HEITETGLTAGQQILGK
    USA300_FPR3757  HEITETGLTAGQQILGK
                    *****************