From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006164000
  • symbol?:
  • description?: MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • MarR family transcriptional regulator
    • TrmB family transcriptional regulator
    • Transcriptional regulator, MarR family
    • marR family protein
    • MarR family regulatory protein
    • MarR family transcriptional regulatory protein
    • transcriptional regulator MarR family
    • penicillinase repressor family protein
  • strand?: -
  • coordinates?: 6236746..6237180
  • synteny block?: BlockID0048890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2456
    08BA02176:
    C248_2578
    11819-97:
    MS7_2526
    71193:
    ST398NM01_2572
    ECT-R 2:
    ECTR2_2372
    ED133:
    SAOV_2564c
    ED98:
    SAAV_2585
    HO 5096 0412:
    SAEMRSA15_24180
    JH1:
    SaurJH1_2595
    JH9:
    SaurJH9_2543
    JKD6008:
    SAA6008_02558
    JKD6159:
    SAA6159_02416
    LGA251:
    SARLGA251_22950
    M013:
    M013TW_2491
    MRSA252:
    SAR2600
    MSHR1132:
    SAMSHR1132_23410
    MSSA476:
    SAS2405
    Mu3:
    SAHV_2504
    Mu50:
    SAV2520
    MW2:
    MW2440
    RF122:
    SAB2394c
    ST398:
    SAPIG2572
    T0131:
    SAT0131_02722 (recA)
    TCH60:
    HMPREF0772_10673
    TW20:
    SATW20_26410
    USA300_TCH1516:
    USA300HOU_2510
    VC40:
    SAVC_11475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRV
    N315            MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRV
    NCTC8325        MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRV
    Newman          MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRV
    USA300_FPR3757  MDRTKQSLNVFVGMNRALDTLEQITKEDVKRYGLNITEFAVLELLYNKGPQPIQRIRDRV
                    ************************************************************

    COL             LIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFD
    N315            LIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFD
    NCTC8325        LIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFD
    Newman          LIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFD
    USA300_FPR3757  LIASSSISYVVSQLEDKGWITREKDKDDKRVYMACLTEKGQSQMADIFPKHAETLTKAFD
                    ************************************************************

    COL             VLTKDELTILQQAFKKLSAQSTEV
    N315            VLTKDELTILQQAFKKLSAQSTEV
    NCTC8325        VLTKDELTILQQAFKKLSAQSTEV
    Newman          VLTKDELTILQQAFKKLSAQSTEV
    USA300_FPR3757  VLTKDELTILQQAFKKLSAQSTEV
                    ************************