From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006178000
  • symbol?: srtA
  • description?: sortase

      descriptions from strain specific annotations:

    • sortase
    • LPXTG specific sortase A
    • sortase A transpeptidase
    • Sortase A, peptide LPXTG peptidoglycan transferase
  • strand?: -
  • coordinates?: 6245281..6245901
  • synteny block?: BlockID0049030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2539 (srtA)
    N315:
    SA2316 (srtA)
    NCTC8325:
    Newman:
    NWMN_2426 (srtA)
    USA300_FPR3757:
    04-02981:
    SA2981_2464 (srtA)
    08BA02176:
    C248_2585 (srtA)
    11819-97:
    MS7_2534 (srtA)
    71193:
    ST398NM01_2578
    ECT-R 2:
    ECTR2_2380
    ED133:
    SAOV_2571c
    ED98:
    SAAV_2593 (srtA)
    HO 5096 0412:
    SAEMRSA15_24270 (srtA)
    JH1:
    SaurJH1_2603
    JH9:
    SaurJH9_2551
    JKD6008:
    SAA6008_02566 (srtA)
    JKD6159:
    SAA6159_02424 (srtA)
    LGA251:
    SARLGA251_23030 (srtA)
    M013:
    M013TW_2500
    MRSA252:
    SAR2608 (srtA)
    MSHR1132:
    SAMSHR1132_23470
    MSSA476:
    SAS2414
    Mu3:
    SAHV_2512 (srtA)
    Mu50:
    SAV2528 (srtA)
    MW2:
    MW2448 (srtA)
    RF122:
    SAB2402c (srtA)
    ST398:
    SAPIG2578
    T0131:
    SAT0131_02731
    TCH60:
    HMPREF0772_10663 (srtA)
    TW20:
    SATW20_26490 (srtA)
    USA300_TCH1516:
    USA300HOU_2517 (srtA)
    VC40:
    SAVC_11515

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
    N315            MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDNKQQ
    NCTC8325        MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
    Newman          MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
    USA300_FPR3757  MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
                    ********************************************************:***

    COL             AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
    N315            AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
    NCTC8325        AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
    Newman          AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
    USA300_FPR3757  AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
                    ************************************************************

    COL             TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
    N315            TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVEVLDEQKGKDKQLT
    NCTC8325        TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
    Newman          TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
    USA300_FPR3757  TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
                    ********************************************** *************

    COL             LITCDDYNEKTGVWEKRKIFVATEVK
    N315            LITCDDYNEKTGVWEKRKIFVATEVK
    NCTC8325        LITCDDYNEKTGVWEKRKIFVATEVK
    Newman          LITCDDYNEKTGVWEKRKIFVATEVK
    USA300_FPR3757  LITCDDYNEKTGVWEKRKIFVATEVK
                    **************************