From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006186000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6250718..6250936
  • synteny block?: BlockID0049110
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2469
    08BA02176:
    11819-97:
    71193:
    ST398NM01_3011
    ECT-R 2:
    ECTR2_2385
    ED133:
    SAOV_2577
    ED98:
    SAAV_2599
    HO 5096 0412:
    SAEMRSA15_24320
    JH1:
    SaurJH1_2609
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_02429
    LGA251:
    SARLGA251_23080
    M013:
    M013TW_2505
    MRSA252:
    SAR2613
    MSHR1132:
    SAMSHR1132_23530
    MSSA476:
    SAS2419
    Mu3:
    SAHV_2517
    Mu50:
    SAV2533
    MW2:
    MW2454
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10658
    TW20:
    SATW20_26540
    USA300_TCH1516:
    VC40:
    SAVC_11540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLS
    N315            MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLS
    NCTC8325        MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLS
    Newman          MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLS
                    ************************************************************

    COL             LPEISFK
    N315            LPEISFK
    NCTC8325        LPEISFK
    Newman          LPEISFK
                    *******