From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006190000
  • symbol?:
  • description?: Thioredoxin

      descriptions from strain specific annotations:

    • Thioredoxin
    • SA2324 protein
    • thioredoxin family protein
  • strand?: -
  • coordinates?: 6253246..6253605
  • synteny block?: BlockID0049150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2472
    08BA02176:
    C248_2593
    11819-97:
    MS7_2541
    71193:
    ST398NM01_2586
    ECT-R 2:
    ECTR2_2388
    ED133:
    SAOV_2580c
    ED98:
    SAAV_2602
    HO 5096 0412:
    SAEMRSA15_24350
    JH1:
    SaurJH1_2612
    JH9:
    SaurJH9_2559
    JKD6008:
    SAA6008_02573
    JKD6159:
    SAA6159_02432
    LGA251:
    SARLGA251_23110
    M013:
    M013TW_2508
    MRSA252:
    SAR2616
    MSHR1132:
    SAMSHR1132_23560
    MSSA476:
    SAS2422
    Mu3:
    SAHV_2520
    Mu50:
    SAV2536
    MW2:
    MW2457
    RF122:
    SAB2410c
    ST398:
    SAPIG2586
    T0131:
    SAT0131_02741
    TCH60:
    HMPREF0772_10655
    TW20:
    SATW20_26570
    USA300_TCH1516:
    USA300HOU_2526
    VC40:
    SAVC_11555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
    N315            MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
    NCTC8325        MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
    Newman          MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
    USA300_FPR3757  MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQV
                    ************************************************************

    COL             EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH----
    N315            EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEHEYRK
    NCTC8325        EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH----
    Newman          EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH----
    USA300_FPR3757  EAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH----
                    ******************************************************