From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006199000
  • symbol?: cidR
  • description?: LysR family transcriptional regulator

      descriptions from strain specific annotations:

    • LysR family transcriptional regulator
    • transcriptional regulator LysR family protein
    • bacterial regulatory helix-turn-helix , lysR family protein
    • LysR-family regulatory protein
    • LysR family regulatory protein CidR
    • LysR substrate-binding
    • regulatory helix-turn-helix protein, lysR family protein
    • transcriptional regulator
    • transcriptional regulator LysR family
  • strand?: -
  • coordinates?: 6261694..6262521
  • synteny block?: BlockID0049230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2478 (cidR)
    08BA02176:
    C248_2599
    11819-97:
    MS7_2547
    71193:
    ST398NM01_2592
    ECT-R 2:
    ECTR2_2394
    ED133:
    SAOV_2586c
    ED98:
    SAAV_2608
    HO 5096 0412:
    SAEMRSA15_24450
    JH1:
    SaurJH1_2618
    JH9:
    SaurJH9_2565
    JKD6008:
    SAA6008_02579
    JKD6159:
    SAA6159_02438
    LGA251:
    SARLGA251_23170 (cidR)
    M013:
    M013TW_2514
    MRSA252:
    SAR2622
    MSHR1132:
    SAMSHR1132_23620
    MSSA476:
    SAS2428
    Mu3:
    SAHV_2526
    Mu50:
    SAV2542
    MW2:
    MW2463
    RF122:
    SAB2416c
    ST398:
    SAPIG2592
    T0131:
    SAT0131_02748 (glpK)
    TCH60:
    HMPREF0772_10649
    TW20:
    SATW20_26630 (cidR)
    USA300_TCH1516:
    USA300HOU_2534
    VC40:
    SAVC_11585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MLVDIKHMKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLIL
    N315            MMLVDIKHMKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLIL
    NCTC8325        --------------------MTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLIL
    Newman          MMLVDIKHMKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLIL
    USA300_FPR3757  MMLVDIKHMKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLIL
                                        ****************************************

    COL             TDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQY
    N315            TDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQY
    NCTC8325        TDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQY
    Newman          TDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQY
    USA300_FPR3757  TDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQY
                    ************************************************************

    COL             PNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAK
    N315            PNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAK
    NCTC8325        PNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAK
    Newman          PNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAK
    USA300_FPR3757  PNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAK
                    ************************************************************

    COL             YETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGI
    N315            YETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGI
    NCTC8325        YETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGI
    Newman          YETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGI
    USA300_FPR3757  YETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGI
                    ************************************************************

    COL             SILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG
    N315            SILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG
    NCTC8325        SILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG
    Newman          SILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG
    USA300_FPR3757  SILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG
                    *******************************************************