From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006209000
  • symbol?:
  • description?: methylated-DNA--protein-cysteine methyltransferase

      descriptions from strain specific annotations:

    • methylated-DNA--protein-cysteine methyltransferase
    • methylated-DNA-[protein]-cysteine S-methyltransferase family protein
    • methylated-DNA-[]-cysteine S-methyltransferase family protein
    • methylated-DNA--[protein]-cysteine S-methyltransferase
    • putative 6-O-methylguanine DNAmethyltransferase
    • 6-O-methylguanine DNA methyltransferase
    • methylated-DNA-protein-cysteine S-methyltransferase
    • O6-methylguanine-DNA methyltransferase
  • strand?: -
  • coordinates?: 6269246..6269767
  • synteny block?: BlockID0049330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2562 (ogt)
    N315:
    SA2335 (adaB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2483 (adaB)
    08BA02176:
    C248_2604
    11819-97:
    MS7_2553
    71193:
    ST398NM01_2597
    ECT-R 2:
    ECTR2_2399
    ED133:
    SAOV_2591c
    ED98:
    SAAV_2613 (ogt)
    HO 5096 0412:
    SAEMRSA15_24500
    JH1:
    SaurJH1_2623
    JH9:
    SaurJH9_2570
    JKD6008:
    SAA6008_02585 (ada)
    JKD6159:
    SAA6159_02443 (ada)
    LGA251:
    SARLGA251_23220
    M013:
    M013TW_2520
    MRSA252:
    SAR2627
    MSHR1132:
    SAMSHR1132_23670
    MSSA476:
    SAS2433
    Mu3:
    SAHV_2531 (adaB)
    Mu50:
    SAV2547 (adaB)
    MW2:
    MW2468 (adaB)
    RF122:
    SAB2422c (adaB)
    ST398:
    SAPIG2597 (ogt)
    T0131:
    SAT0131_02756 (miaA)
    TCH60:
    HMPREF0772_10644 (ogt)
    TW20:
    SATW20_26690
    USA300_TCH1516:
    USA300HOU_2541 (ogt)
    VC40:
    SAVC_11615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGD
    N315            MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGD
    NCTC8325        MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGD
    Newman          MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGD
    USA300_FPR3757  MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGD
                    ************************************************************

    COL             NPEITIPLKPTGSHFQQCVWNELRQVPYGTLTTYGAIAKKVGKLLNKPKMSAQAVGGAVG
    N315            NPEITIPLKPTGSHFQQCVWNELRQVPYGTLTTYGAIAKKVGKVLDKPKMSAQAVGGAVG
    NCTC8325        NPEITIPLKPTGSHFQQCVWNELRQVPYGTLTTYGAIAKKVGKLLNKPKMSAQAVGGAVG
    Newman          NPEITIPLKPTGSHFQQCVWNELRQVPYGTLTTYGAIAKKVGKLLNKPKMSAQAVGGAVG
    USA300_FPR3757  NPEITIPLKPTGSHFQQCVWNELRQVPYGTLTTYGAIAKKVGKLLNKPKMSAQAVGGAVG
                    *******************************************:*:**************

    COL             SNPLSIIVPCHRVVGKTGSLTGFGGTINNKIKLLELENIDMSKLYVPKHSTKP
    N315            SNPLSIIVPCHRVVGKTGSLTGFGGTINNKIKLLELENIDMSKLYIPKHSTKP
    NCTC8325        SNPLSIIVPCHRVVGKTGSLTGFGGTINNKIKLLELENIDMSKLYVPKHSTKP
    Newman          SNPLSIIVPCHRVVGKTGSLTGFGGTINNKIKLLELENIDMSKLYVPKHSTKP
    USA300_FPR3757  SNPLSIIVPCHRVVGKTGSLTGFGGTINNKIKLLELENIDMSKLYVPKHSTKP
                    *********************************************:*******