From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006212000
  • symbol?: feoB
  • description?: ferrous iron transport protein B

      descriptions from strain specific annotations:

    • ferrous iron transport protein B
    • ferrous iron transporter B
    • FeoB family ferrous iron (Fe2+) uptake protein
    • ferrous iron transport protein B-like protein
    • putative ferrous iron transport protein B
  • strand?: -
  • coordinates?: 6272639..6274633
  • synteny block?: BlockID0049360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2564 (feoB)
    N315:
    SA2337 (feoB)
    NCTC8325:
    Newman:
    NWMN_2450 (feoB)
    USA300_FPR3757:
    04-02981:
    SA2981_2486 (feoB)
    08BA02176:
    C248_2607
    11819-97:
    MS7_2556 (feoB)
    71193:
    ST398NM01_2600
    ECT-R 2:
    ECTR2_2402 (feoB)
    ED133:
    SAOV_2594c
    ED98:
    SAAV_2616
    HO 5096 0412:
    SAEMRSA15_24530
    JH1:
    SaurJH1_2626
    JH9:
    SaurJH9_2572
    JKD6008:
    SAA6008_02588
    JKD6159:
    SAA6159_02446
    LGA251:
    SARLGA251_23250
    M013:
    M013TW_2523
    MRSA252:
    SAR2630
    MSHR1132:
    SAMSHR1132_23700
    MSSA476:
    SAS2436
    Mu3:
    SAHV_2534 (feoB)
    Mu50:
    SAV2550 (feoB)
    MW2:
    MW2471 (feoB)
    RF122:
    SAB2424c (feoB)
    ST398:
    SAPIG2600 (feoB)
    T0131:
    SAT0131_02759 (gpxA1)
    TCH60:
    HMPREF0772_10641 (feoB)
    TW20:
    SATW20_26720
    USA300_TCH1516:
    USA300HOU_2544
    VC40:
    SAVC_11630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENYCILGNPNVGKTSLFNALTGSYEYIGNWSGVTVEKKVGKLKENVGQLIDLPGTYDLS
    N315            MENYCILGNPNVGKTSLFNALTGSYEYIGNWSGVTVEKKVGKLKENVGQLIDLPGTYDLS
    NCTC8325        MENYCILGNPNVGKTSLFNALTGSYEYIGNWSGVTVEKKVGKLKENVGQLIDLPGTYDLS
    Newman          MENYCILGNPNVGKTSLFNALTGSYEYIGNWSGVTVEKKVGKLKENVGQLIDLPGTYDLS
    USA300_FPR3757  MENYCILGNPNVGKTSLFNALTGSYEYIGNWSGVTVEKKVGKLKENVGQLIDLPGTYDLS
                    ************************************************************

    COL             PISKDETVVTDYLLNDSFSGIINIVDASQLKRNMQLTVQLLELNQPIYIGLNMIDVATKR
    N315            PISKDETVVTDYLLNDSFSGIINIVDASQLKRNVQLTVQLLELNQPIYIGLNMIDVATKR
    NCTC8325        PISKDETVVTDYLLNDSFSGIINIVDASQLKRNMQLTVQLLELNQPIYIGLNMIDVATKR
    Newman          PISKDETVVTDYLLNDSFSGIINIVDASQLKRNMQLTVQLLELNQPIYIGLNMIDVATKR
    USA300_FPR3757  PISKDETVVTDYLLNDSFSGIINIVDASQLKRNMQLTVQLLELNQPIYIGLNMIDVATKR
                    *********************************:**************************

    COL             GIKIDYHKLMKKLKTPIFPVVARTGKGTKYLLGEIKHLGEGYQPHFKINYGEKIEETIKN
    N315            GIKIDYHKLMKKLKTPIFPVVARTGKGTKYLLGEIKHLGEGYQPHFKINYGEKIEETIKN
    NCTC8325        GIKIDYHKLMKKLKTPIFPVVARTGKGTKYLLGEIKHLGEGYQPHFKINYGEKIEETIKN
    Newman          GIKIDYHKLMKKLKTPIFPVVARTGKGTKYLLGEIKHLGEGYQPHFKINYGEKIEETIKN
    USA300_FPR3757  GIKIDYHKLMKKLKTPIFPVVARTGKGTKYLLGEIKHLGEGYQPHFKINYGEKIEETIKN
                    ************************************************************

    COL             MCQIIMTETSHDKYQARFIAIQFLLNNMQIANELNSEVVNKLSSLRDQVAEQVGAVSVRR
    N315            MCQIIMTETSHDKYQARFIAIQFLLNNMQIANELNSEVVNKLSSLRDQVAEQVGAVSVRR
    NCTC8325        MCQIIMTETSHDKYQARFIAIQFLLNNMQIANELNSEVVNKLSSLRDQVAEQVGAVSVRR
    Newman          MCQIIMTETSHDKYQARFIAIQFLLNNMQIANELNSEVVNKLSSLRDQVAEQVGAVSVRR
    USA300_FPR3757  MCQIIMTETSHDKYQARFIAIQFLLNNMQIANELNSEVVNKLSSLRDQVAEQVGAVSVRR
                    ************************************************************

    COL             EMERIRNHYIETLLQDVVTYPDEDKQYFSSRIDKILTHKYIGMPIFLAIMWLIFQTTFTW
    N315            EMERIRNHYIETLLQDVVTYPDEDKQYFSSRIDKILTHKYIGMPIFLAIMWLIFQTTFTW
    NCTC8325        EMERIRNHYIETLLQDVVTYPDEDKQYFSSRIDKILTHKYIGMPIFLAIMWLIFQTTFTW
    Newman          EMERIRNHYIETLLQDVVTYPDEDKQYFSSRIDKILTHKYIGMPIFLAIMWLIFQTTFTW
    USA300_FPR3757  EMERIRNHYIETLLQDVVTYPDEDKQYFSSRIDKILTHKYIGMPIFLAIMWLIFQTTFTW
                    ************************************************************

    COL             IGTPLSDQLDAFIGGTFTDSVKTIMNYLGVIPFLQDLITDGIIAGVGSVLVFVPQIVVLF
    N315            IGTPLSDQLDAFIGGTFTDSVKTIMNYLGVIPFLQDLITDGIIAGVGSVLVFVPQIVVLF
    NCTC8325        IGTPLSDQLDAFIGGTFTDSVKTIMNYLGVIPFLQDLITDGIIAGVGSVLVFVPQIVVLF
    Newman          IGTPLSDQLDAFIGGTFTDSVKTIMNYLGVIPFLQDLITDGIIAGVGSVLVFVPQIVVLF
    USA300_FPR3757  IGTPLSDQLDAFIGGTFTDSVKTIMNYLGVIPFLQDLITDGIIAGVGSVLVFVPQIVVLF
                    ************************************************************

    COL             FFISLLEDSGYMARIAVLMDRIMESFGLSGKSFIPMIIGFGCNVPSIMAARSIENEKERL
    N315            FFISLLEDSGYMARIAVLMDRIMESFGLSGKSFIPMIIGFGCNVPSIMAARSIENEKERL
    NCTC8325        FFISLLEDSGYMARIAVLMDRIMESFGLSGKSFIPMIIGFGCNVPSIMAARSIENEKERL
    Newman          FFISLLEDSGYMARIAVLMDRIMESFGLSGKSFIPMIIGFGCNVPSIMAARSIENEKERL
    USA300_FPR3757  FFISLLEDSGYMARIAVLMDRIMESFGLSGKSFIPMIIGFGCNVPSIMAARSIENEKERL
                    ************************************************************

    COL             TTILIAPFMSCSARLPVYALFVGIFFKENQSLVVLSLYVLGIIMAFLVSTVLTKTILKND
    N315            TTILIAPFMSCSARLPVYALFVGIFFKENQSLVVLSLYVLGIIMAFLVSTVLTKTILKND
    NCTC8325        TTILIAPFMSCSARLPVYALFVGIFFKENQSLVVLSLYVLGIIMAFLVSTVLTKTILKND
    Newman          TTILIAPFMSCSARLPVYALFVGIFFKENQSLVVLSLYVLGIIMAFLVSTVLTKTILKND
    USA300_FPR3757  TTILIAPFMSCSARLPVYALFVGIFFKENQSLVVLSLYVLGIIMAFLVSTVLTKTILKND
                    ************************************************************

    COL             NAIFIVELPTYRVPSIKTLWRSTWEKAKGFVRKAGTFIFGGSVVIWLLSYVGPHGINVNI
    N315            NAIFIVELPTYRVPSIKTLWRSTWEKAKGFVRKAGTFIFGGSVVIWLLSYVGPHGINVNI
    NCTC8325        NAIFIVELPTYRVPSIKTLWRSTWEKAKGFVRKAGTFIFGGSVVIWLLSYVGPHGINVNI
    Newman          NAIFIVELPTYRVPSIKTLWRSTWEKAKGFVRKAGTFIFGGSVVIWLLSYVGPHGINVNI
    USA300_FPR3757  NAIFIVELPTYRVPSIKTLWRSTWEKAKGFVRKAGTFIFGGSVVIWLLSYVGPHGINVNI
                    ************************************************************

    COL             NQSFLHMVGSFFGMLVQPLGFGTWQAGATLVPGFLAKEVIVSSMAIIYSSGDAGLVNVIQ
    N315            NQSFLHMVGSFFGMLVQPLGFGTWQAGATLVPGFLAKEVIVSSMAIIYSSGDAGLVNVIQ
    NCTC8325        NQSFLHMVGSFFGMLVQPLGFGTWQAGATLVPGFLAKEVIVSSMAIIYSSGDAGLVNVIQ
    Newman          NQSFLHMVGSFFGMLVQPLGFGTWQAGATLVPGFLAKEVIVSSMAIIYSSGDAGLVNVIQ
    USA300_FPR3757  NQSFLHMVGSFFGMLVQPLGFGTWQAGATLVPGFLAKEVIVSSMAIIYSSGDAGLVNVIQ
                    ************************************************************

    COL             NQFTPLSAYAFMIFILLYIPCVSTVAAIRKETYSWKWTALAVAYPLVTAYVLTFIFYQVG
    N315            NQFTPLSAYAFMIFILLYIPCVSTVAAIRKETYSWKWTALAVAYPLVTAYVLTFIFYQVG
    NCTC8325        NQFTPLSAYAFMIFILLYIPCVSTVAAIRKETYSWKWTALAVAYPLVTAYVLTFIFYQVG
    Newman          NQFTPLSAYAFMIFILLYIPCVSTVAAIRKETYSWKWTALAVAYPLVTAYVLTFIFYQVG
    USA300_FPR3757  NQFTPLSAYAFMIFILLYIPCVSTVAAIRKETYSWKWTALAVAYPLVTAYVLTFIFYQVG
                    ************************************************************

    COL             HLFV
    N315            HLFV
    NCTC8325        HLFV
    Newman          HLFV
    USA300_FPR3757  HLFV
                    ****