From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006215000
  • symbol?:
  • description?: TetR/AcrR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR/AcrR family transcriptional regulator
    • TetR family regulatory protein
    • bacterial regulatory s, tetR family protein
    • conserved regulatory protein
    • regulatory proteins, tetR family protein
    • TetR family transcriptional regulator
  • strand?: +
  • coordinates?: 6277770..6278318
  • synteny block?: BlockID0049390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2489
    08BA02176:
    C248_2610
    11819-97:
    MS7_2559
    71193:
    ST398NM01_2603
    ECT-R 2:
    ECTR2_2405
    ED133:
    SAOV_2597
    ED98:
    SAAV_2619
    HO 5096 0412:
    SAEMRSA15_24560
    JH1:
    SaurJH1_2629
    JH9:
    SaurJH9_2575
    JKD6008:
    SAA6008_02591
    JKD6159:
    SAA6159_02449
    LGA251:
    SARLGA251_23280
    M013:
    M013TW_2526
    MRSA252:
    SAR2633
    MSHR1132:
    SAMSHR1132_23730
    MSSA476:
    SAS2439
    Mu3:
    SAHV_2537
    Mu50:
    SAV2553
    MW2:
    MW2474
    RF122:
    SAB2427
    ST398:
    SAPIG2603
    T0131:
    SAT0131_02763
    TCH60:
    HMPREF0772_10638
    TW20:
    SATW20_26750
    USA300_TCH1516:
    USA300HOU_2547
    VC40:
    SAVC_11645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------MLEQQLFQTITVNQICDNALVHRTTFYKHFYDKYDLLEY
    N315            MKETDLRVIKTKKALSSSLLQLLEQQLFQTITVNQICDNALVHRTTFYKHFYDKYDLLEY
    NCTC8325        MKETDLRVIKTKKALSSSLLQLLEQQLFQTITVNQICDNALVHRTTFYKHFYDKYDLLEY
    Newman          ---------------------MLEQQLFQTITVNQICDNALVHRTTFYKHFYDKYDLLEY
    USA300_FPR3757  MKETDLRVIKTKKALSSSLLQLLEQQLFQTITVNQICDNALVHRTTFYKHFYDKYDLLEY
                                         :**************************************

    COL             LFNQLTKDYFARDISDRLNHPFQTMSDTINNKEDLREIAEFQEEDAEFNKVLKNVCIKIM
    N315            LFNQLTKDYFARDISDRLNHPFQTMSDTINNKEDLREIAEFQEEDAEFNKVLKNVCIKIM
    NCTC8325        LFNQLTKDYFARDISDRLNHPFQTMSDTINNKEDLREIAEFQEEDAEFNKVLKNVCIKIM
    Newman          LFNQLTKDYFARDISDRLNHPFQTMSDTINNKEDLREIAEFQEEDAEFNKVLKNVCIKIM
    USA300_FPR3757  LFNQLTKDYFARDISDRLNHPFQTMSDTINNKEDLREIAEFQEEDAEFNKVLKNVCIKIM
                    ************************************************************

    COL             HNDIKNNRDRIDIDSDIPDNLIFYIYDSLIEGFIHWIKDEKIDWPGEDIDNIFHRLINIK
    N315            HNDIKNNRDRIDIDSDIPDNLIFYIYDSLIEGFIHWIKDEKIDWPGEDIDNIFHRLINIK
    NCTC8325        HNDIKNNRDRIDIDSDIPDNLIFYIYDSLIEGFIHWIKDEKIDWPGEDIDNIFHRLINIK
    Newman          HNDIKNNRDRIDIDSDIPDNLIFYIYDSLIEGFIHWIKDEKIDWPGEDIDNIFHRLINIK
    USA300_FPR3757  HNDIKNNRDRIDIDSDIPDNLIFYIYDSLIEGFIHWIKDEKIDWPGEDIDNIFHRLINIK
                    ************************************************************

    COL             IK
    N315            IK
    NCTC8325        IK
    Newman          IK
    USA300_FPR3757  IK
                    **