From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006218000
  • symbol?:
  • description?: acetyltransferase

      descriptions from strain specific annotations:

    • acetyltransferase
    • hexapaptide repeat-containing transferase
    • galactoside O-acetyltransferase
    • Maltose O-acetyltransferase
    • galactoside O-acetyltransferase (GAT) (Thiogalactosideacetyltransferase)
    • acetyltransferase family protein
    • putative acetyltransferase
    • galactose-6-phosphate isomerase subunit LacA
    • O-acetyltransferase (cell wall biosynthesis)
  • strand?: -
  • coordinates?: 6280411..6280998
  • synteny block?: BlockID0049420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2492
    08BA02176:
    C248_2613
    11819-97:
    MS7_2562
    71193:
    ST398NM01_2606
    ECT-R 2:
    ECTR2_2408
    ED133:
    SAOV_2600c
    ED98:
    SAAV_2621
    HO 5096 0412:
    SAEMRSA15_24580
    JH1:
    SaurJH1_2631
    JH9:
    SaurJH9_2577
    JKD6008:
    SAA6008_02594
    JKD6159:
    SAA6159_02451
    LGA251:
    SARLGA251_23300
    M013:
    M013TW_2529
    MRSA252:
    SAR2635
    MSHR1132:
    SAMSHR1132_23760
    MSSA476:
    SAS2441
    Mu3:
    SAHV_2539
    Mu50:
    SAV2555
    MW2:
    MW2476
    RF122:
    SAB2429c
    ST398:
    SAPIG2606 (maa)
    T0131:
    SAT0131_02766
    TCH60:
    HMPREF0772_10635 (lacA)
    TW20:
    SATW20_26770
    USA300_TCH1516:
    USA300HOU_2550
    VC40:
    SAVC_11655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDN
    N315            MTEKEKMLAEKWYDANFDQDLINERARAKDICFELNHTKPSDTNKRKELIDQLFQTTTDN
    NCTC8325        MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDN
    Newman          MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDN
    USA300_FPR3757  MTEKEKMLAEKWYDANFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDN
                    ******************* ******************:** ******************

    COL             VSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHH
    N315            VSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFYH
    NCTC8325        VSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHH
    Newman          VSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHH
    USA300_FPR3757  VSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHH
                    **********************************************************:*

    COL             RNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV
    N315            RNEGYEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV
    NCTC8325        RNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV
    Newman          RNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV
    USA300_FPR3757  RNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV
                    ****:*******************************************************

    COL             VRKIDNDLPSETLNDETIK
    N315            VRKIDNDLPSETLNDETIK
    NCTC8325        VRKIDNDLPSETLNDETIK
    Newman          VRKIDNDLPSETLNDETIK
    USA300_FPR3757  VRKIDNDLPSETLNDETIK
                    *******************