From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006225000
  • symbol?: crtN
  • description?: squalene synthase

      descriptions from strain specific annotations:

    • squalene synthase
    • Dehydrosqualene desaturase (Diapophytoene desaturase) (4,4-diapophytoene desaturase)
    • phytoene desaturase family protein
  • strand?: -
  • coordinates?: 6288467..6289975
  • synteny block?: BlockID0049490
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2576 (crtN)
    N315:
    SA2348 (crtN)
    NCTC8325:
    Newman:
    NWMN_2461 (crtN)
    USA300_FPR3757:
    04-02981:
    SA2981_2498 (crtN)
    08BA02176:
    C248_2619 (crtN)
    11819-97:
    MS7_2568 (crtI)
    71193:
    ST398NM01_2612
    ECT-R 2:
    ECTR2_2414 (crtI)
    ED133:
    SAOV_2606c
    ED98:
    SAAV_2627 (crtN)
    HO 5096 0412:
    SAEMRSA15_24640 (crtN)
    JH1:
    SaurJH1_2637
    JH9:
    SaurJH9_2583
    JKD6008:
    SAA6008_02600 (crtN)
    JKD6159:
    SAA6159_02457 (crtN)
    LGA251:
    SARLGA251_23360 (crtN)
    M013:
    M013TW_2535
    MRSA252:
    SAR2642 (crtN)
    MSHR1132:
    MSSA476:
    SAS2447
    Mu3:
    SAHV_2545 (crtN)
    Mu50:
    SAV2561 (crtN)
    MW2:
    MW2482 (crtN)
    RF122:
    SAB2434c (crtN)
    ST398:
    SAPIG2612
    T0131:
    SAT0131_02772
    TCH60:
    HMPREF0772_10628 (crtN)
    TW20:
    SATW20_26830 (crtN)
    USA300_TCH1516:
    USA300HOU_2556 (crtN)
    VC40:
    SAVC_11685

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGCMNQLKKDGFTFDMGPTIVMMPD
    N315            MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKKDGFTFDMGPTIVMMPD
    NCTC8325        MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKKDGFTFDMGPTIVMMPD
    Newman          MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKKDGFTFDMGPTIVMMPD
    USA300_FPR3757  MKIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKKDGFTFDMGPTIVMMPD
                    ************************************* **********************

    COL             VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
    N315            VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
    NCTC8325        VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
    Newman          VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
    USA300_FPR3757  VYKDVFTACGKNYEDYIELRQLRYIYDVYFDHDDRITVPTDLAELQQMLESIEPGSTHGF
                    ************************************************************

    COL             MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
    N315            MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
    NCTC8325        MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
    Newman          MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
    USA300_FPR3757  MSFLTDVYKKYEIARRYFLERTYRKPSDFYNMTSLVQGAKLKTLNHADQLIEHYIDNEKI
                    ************************************************************

    COL             QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
    N315            QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
    NCTC8325        QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
    Newman          QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
    USA300_FPR3757  QKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIE
                    ************************************************************

    COL             LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
    N315            LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
    NCTC8325        LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
    Newman          LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
    USA300_FPR3757  LNAEIEQIIIDPKFKRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKI
                    ************************************************************

    COL             ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
    N315            ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
    NCTC8325        ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
    Newman          ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
    USA300_FPR3757  ADLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAV
                    ************************************************************

    COL             ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
    N315            ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
    NCTC8325        ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
    Newman          ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
    USA300_FPR3757  ADKSLAPEGKTGIYVLMPTPELKTGSGIDWSDEALTQQIKEIIYRKLATIEVFEDIKSHI
                    ************************************************************

    COL             VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
    N315            VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
    NCTC8325        VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
    Newman          VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
    USA300_FPR3757  VSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQNVSRDYKDLYFAGASTHPGAGV
                    ************************************************************

    COL             PIVLTSAKITVDEMIKDIERGV
    N315            PIVLTSAKITVDEMIKDIERGV
    NCTC8325        PIVLTSAKITVDEMIKDIERGV
    Newman          PIVLTSAKITVDEMIKDIERGV
    USA300_FPR3757  PIVLTSAKITVDEMIKDIERGV
                    **********************