Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006226000
  • symbol?: crtM
  • description?: squalene synthase

      descriptions from strain specific annotations:

    • squalene synthase
    • squalene desaturase
    • dehydrosqualene synthase
    • squalene/phytoene synthase
    • squalene/phytoene synthase family protein
    • pseudogene
    • dehydrosqualene synthase (Diapophytoene synthase) (4,4'-diapophytoene synthase) (DAP synthase)
  • strand?: -
  • coordinates?: 6289987..6290850
  • synteny block?: BlockID0049500
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2577 (crtM)
    N315:
    SA2349 (crtM)
    NCTC8325:
    Newman:
    NWMN_2462 (crtM)
    USA300_FPR3757:
    04-02981:
    SA2981_2499 (crtM)
    08BA02176:
    C248_2620 (crtM)
    11819-97:
    MS7_2569 (crtM)
    71193:
    ST398NM01_2613
    ECT-R 2:
    ECTR2_2415
    ED133:
    SAOV_2607c
    ED98:
    SAAV_2628 (crtM)
    HO 5096 0412:
    SAEMRSA15_24650 (crtM)
    JH1:
    SaurJH1_2638
    JH9:
    SaurJH9_2584
    JKD6008:
    SAA6008_02601
    JKD6159:
    SAA6159_02458
    LGA251:
    SARLGA251_23370 (crtM)
    M013:
    M013TW_2536
    MRSA252:
    SAR2643 (crtM)
    MSHR1132:
    MSSA476:
    SAS2448
    Mu3:
    SAHV_2546 (crtM)
    Mu50:
    SAV2562 (crtM)
    MW2:
    MW2483 (crtM)
    RF122:
    SAB2435c (crtM)
    ST398:
    SAPIG2613
    T0131:
    SAT0131_02773
    TCH60:
    HMPREF0772_10627 (crtM)
    TW20:
    SATW20_26840 (crtM)
    USA300_TCH1516:
    USA300HOU_2557 (crtM)
    VC40:
    SAVC_11690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
    N315            MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
    NCTC8325        MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
    Newman          MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
    USA300_FPR3757  MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
                    ************************************************************

    COL             NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
    N315            NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
    NCTC8325        NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
    Newman          NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
    USA300_FPR3757  NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
                    ************************************************************

    COL             ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
    N315            ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
    NCTC8325        ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
    Newman          ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
    USA300_FPR3757  ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
                    ************************************************************

    COL             RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
    N315            RVYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
    NCTC8325        RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
    Newman          RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
    USA300_FPR3757  RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
                    *:**********************************************************

    COL             IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
    N315            IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
    NCTC8325        IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
    Newman          IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
    USA300_FPR3757  IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
                    ***********************************************