From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006232000
  • symbol?: oatA
  • description?: O-acetyltransferase OatA

      descriptions from strain specific annotations:

    • O-acetyltransferase OatA
    • acyltransferase
    • acetyltransferase
    • acyltransferase 3
    • acyltransferase family protein
    • membrane-embedded acyltransferase
  • strand?: -
  • coordinates?: 6295586..6297403
  • synteny block?: BlockID0049560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2504
    08BA02176:
    C248_2626
    11819-97:
    MS7_2574
    71193:
    ST398NM01_2618
    ECT-R 2:
    ECTR2_2420
    ED133:
    SAOV_2613c
    ED98:
    SAAV_2633
    HO 5096 0412:
    SAEMRSA15_24700
    JH1:
    SaurJH1_2644
    JH9:
    SaurJH9_2589
    JKD6008:
    SAA6008_02606
    JKD6159:
    SAA6159_02463
    LGA251:
    SARLGA251_23420
    M013:
    M013TW_2541
    MRSA252:
    SAR2649
    MSHR1132:
    SAMSHR1132_23830
    MSSA476:
    SAS2453
    Mu3:
    SAHV_2551
    Mu50:
    SAV2567
    MW2:
    MW2488
    RF122:
    SAB2441c
    ST398:
    SAPIG2618
    T0131:
    SAT0131_02778
    TCH60:
    HMPREF0772_10622
    TW20:
    SATW20_26890
    USA300_TCH1516:
    USA300HOU_2562
    VC40:
    SAVC_11715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDTKDFKRLEKMYSPRYLPGLDGLRAFAVIGIIIYHLNAQWLSGGFLGVDTFFVISGYLI
    N315            MDTKDFKRLEKMYSPRYLPGLDGLRAFAVIGIIIYHLNAQWLSGGFLGVDTFFVISGYLI
    NCTC8325        MDTKDFKRLEKMYSPRYLPGLDGLRAFAVIGIIIYHLNAQWLSGGFLGVDTFFVISGYLI
    Newman          MDTKDFKRLEKMYSPRYLPGLDGLRAFAVIGIIIYHLNAQWLSGGFLGVDTFFVISGYLI
    USA300_FPR3757  MDTKDFKRLEKMYSPRYLPGLDGLRAFAVIGIIIYHLNAQWLSGGFLGVDTFFVISGYLI
                    ************************************************************

    COL             TSLLISEYYRTQKIDLLEFWKRRLKRLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAA
    N315            TSLLISEYYRTQKIDLLEFWKRRLKRLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAA
    NCTC8325        TSLLISEYYRTQKIDLLEFWKRRLKRLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAA
    Newman          TSLLISEYYRTQKIDLLEFWKRRLKRLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAA
    USA300_FPR3757  TSLLISEYYRTQKIDLLEFWKRRLKRLIPAVLFLICVVLTFTLIFKPELIIQMKRDAIAA
                    ************************************************************

    COL             IFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEEQFYLLFPLVITFLLHRFKPRNIIQT
    N315            IFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEEQFYLLFPLVITFLLHRFKPRNIIQT
    NCTC8325        IFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEEQFYLLFPLVITFLLHRFKPRNIIQT
    Newman          IFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEEQFYLLFPLVITFLLHRFKPRNIIQT
    USA300_FPR3757  IFYVSNWWYISQNVDYFNQFAIEPLKHLWSLAIEEQFYLLFPLVITFLLHRFKPRNIIQT
                    ************************************************************

    COL             LFIVSLISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGCILAFIWPPFALKKDISKKIV
    N315            LFIVSLISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGCILAFIWPPFALKKDISKKIV
    NCTC8325        LFIVSLISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGCILAFIWPPFALKKDISKKIV
    Newman          LFIVSLISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGCILAFIWPPFALKKDISKKIV
    USA300_FPR3757  LFIVSLISLGLMIVIHFITGDNSRVYFGTDTRLQTLLLGCILAFIWPPFALKKDISKKIV
                    ************************************************************

    COL             VSLDIIGISGFAVLMTLFFIVGDQDQWIYNGGFYIISFATLFIIAIAVHPSSLFAKFLSM
    N315            VSLDIIGISGFAVLMTLFFIVGDQDQWIYNGGFYIISFATLFIIAIAVHPSSLFAKFLSM
    NCTC8325        VSLDIIGISGFAVLMTLFFIVGDQDQWIYNGGFYIISFATLFIIAIAVHPSSLFAKFLSM
    Newman          VSLDIIGISGFAVLMTLFFIVGDQDQWIYNGGFYIISFATLFIIAIAVHPSSLFAKFLSM
    USA300_FPR3757  VSLDIIGISGFAVLMTLFFIVGDQDQWIYNGGFYIISFATLFIIAIAVHPSSLFAKFLSM
                    ************************************************************

    COL             KPLLIIGKRSYSLYLWHYPIIVFVNSYYVQGQIPVYVYIIEILLTALMAEISYRFIETPI
    N315            KPLLIIGKRSYSLYLWHYPIIVFVNSYYVQGQIPVYVYIIEILLTALMAEISYRFIETPI
    NCTC8325        KPLLIIGKRSYSLYLWHYPIIVFVNSYYVQGQIPVYVYIIEILLTALMAEISYRFIETPI
    Newman          KPLLIIGKRSYSLYLWHYPIIVFVNSYYVQGQIPVYVYIIEILLTALMAEISYRFIETPI
    USA300_FPR3757  KPLLIIGKRSYSLYLWHYPIIVFVNSYYVQGQIPVYVYIIEILLTALMAEISYRFIETPI
                    ************************************************************

    COL             RKKGFKAFAFLPKKKGQFARTVLVILLLVPSIVVLSGQFDALGKQHEAEKKEKKTEFKTT
    N315            RKKGFKAFAFLPKKKGQFARTVLVILLLVPSIVVLSGQFDALGKQHEAEKKEKKTEFKTT
    NCTC8325        RKKGFKAFAFLPKKKGQFARTVLVILLLVPSIVVLSGQFDALGKQHEAEKKEKKTEFKTT
    Newman          RKKGFKAFAFLPKKKGQFARTVLVILLLVPSIVVLSGQFDALGKQHEAEKKEKKTEFKTT
    USA300_FPR3757  RKKGFKAFAFLPKKKGQFARTVLVILLLVPSIVVLSGQFDALGKQHEAEKKEKKTEFKTT
                    ************************************************************

    COL             KKKVVKKDKQEDKQTANSKEDIKKSSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLV
    N315            KKKVVKKDKQEDKQTANSKEDIKKSSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLV
    NCTC8325        KKKVVKKDKQEDKQTANSKEDIKKSSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLV
    Newman          KKKVVKKDKQEDKQTANSKEDIKKSSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLV
    USA300_FPR3757  KKKVVKKDKQEDKQTANSKEDIKKSSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLV
                    ************************************************************

    COL             DATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEG
    N315            DATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEG
    NCTC8325        DATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEG
    Newman          DATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEG
    USA300_FPR3757  DATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEG
                    ************************************************************

    COL             RINKLIYEAAEKRSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHAT
    N315            RINKLIYEAAEKRSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHAT
    NCTC8325        RINKLIYEAAEKRSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHAT
    Newman          RINKLIYEAAEKRSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHAT
    USA300_FPR3757  RINKLIYEAAEKRSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHAT
                    ************************************************************

    COL             NKK
    N315            NKK
    NCTC8325        NKK
    Newman          NKK
    USA300_FPR3757  NKK
                    ***