From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006236000
  • symbol?:
  • description?: Regulatory protein

      descriptions from strain specific annotations:

    • Regulatory protein
    • membrane spanning protein
    • toxin regulatorly-like protein
    • membrane-embedded regulatory protein
    • Membrane protein
    • Regulatory protein, putative
  • strand?: -
  • coordinates?: 6301830..6302885
  • synteny block?: BlockID0049600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2507 (pfoS/R)
    08BA02176:
    C248_2628
    11819-97:
    MS7_2576
    71193:
    ST398NM01_2620
    ECT-R 2:
    ECTR2_2424
    ED133:
    SAOV_2615c
    ED98:
    SAAV_2636
    HO 5096 0412:
    SAEMRSA15_24730
    JH1:
    SaurJH1_2647
    JH9:
    SaurJH9_2592
    JKD6008:
    SAA6008_02608
    JKD6159:
    SAA6159_02465
    LGA251:
    SARLGA251_23450
    M013:
    M013TW_2544
    MRSA252:
    SAR2651
    MSHR1132:
    SAMSHR1132_23860
    MSSA476:
    SAS2456
    Mu3:
    SAHV_2554
    Mu50:
    SAV2570
    MW2:
    MW2491
    RF122:
    SAB2444c
    ST398:
    SAPIG2620
    T0131:
    SAT0131_02780
    TCH60:
    HMPREF0772_10620
    TW20:
    SATW20_26910
    USA300_TCH1516:
    USA300HOU_2565
    VC40:
    SAVC_11730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSIKTITPKDFIFRVLSGVAIGIVAGLVPNAILGEIFKYFMDYHPIFKTLLGVVVAIQF
    N315            MTSIKTITPKDFIFRVLSGVAIGIVAGLVPNAILGEIFKYFMDYHPIFKTLLGVVVAIQF
    NCTC8325        MTSIKTITPKDFIFRVLSGVAIGIVAGLVPNAILGEIFKYFMDYHPIFKTLLGVVVAIQF
    Newman          MTSIKTITPKDFIFRVLSGVAIGIVAGLVPNAILGEIFKYFMDYHPIFKTLLGVVVAIQF
    USA300_FPR3757  MTSIKTITPKDFIFRVLSGVAIGIVAGLVPNAILGEIFKYFMDYHPIFKTLLGVVVAIQF
                    ************************************************************

    COL             TVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQFKNGAWMITGIGDLINTMITAAIA
    N315            TVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQFKNGAWMITGIGDLINTMITAAIA
    NCTC8325        TVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQFKNGAWMITGIGDLINTMITAAIA
    Newman          TVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQFKNGAWMITGIGDLINTMITAAIA
    USA300_FPR3757  TVPALIGALVAMKFDLSPLAIAVVASAAYVGSGAAQFKNGAWMITGIGDLINTMITAAIA
                    ************************************************************

    COL             VLFILLIQHRVGSMALIVFPTVVGGISGAIGVLILPYTKMITTAIGNMVNGFTELQPIVM
    N315            VLFILLIQHRVGSMALIVFPTVVGGISGAIGVLILPYTKMITTAIGNMVNGFTELQPIVM
    NCTC8325        VLFILLIQHRVGSMALIVFPTVVGGISGAIGVLILPYTKMITTAIGNMVNGFTELQPIVM
    Newman          VLFILLIQHRVGSMALIVFPTVVGGISGAIGVLILPYTKMITTAIGNMVNGFTELQPIVM
    USA300_FPR3757  VLFILLIQHRVGSMALIVFPTVVGGISGAIGVLILPYTKMITTAIGNMVNGFTELQPIVM
                    ************************************************************

    COL             SILISMVFSLIIISPLSTVAIAFAIGITGLAAGSASIGISATEAVLIIGTSKVNRLGVPL
    N315            SILISMVFSLIIISPLSTVAIAFAIGITGLAAGSASIGISATEAVLIIGTSKVNRLGVPL
    NCTC8325        SILISMVFSLIIISPLSTVAIAFAIGITGLAAGSASIGISATEAVLIIGTSKVNRLGVPL
    Newman          SILISMVFSLIIISPLSTVAIAFAIGITGLAAGSASIGISATEAVLIIGTSKVNRLGVPL
    USA300_FPR3757  SILISMVFSLIIISPLSTVAIAFAIGITGLAAGSASIGISATEAVLIIGTSKVNRLGVPL
                    ************************************************************

    COL             SVFFGGVKMMIPNMVKYPILMLPILTTAIVSGLVSALVGIHGTKESAGFGFIGMVGPINA
    N315            SVFFGGVKMMIPNMVKYPILMLPILTTAIVSGLVSALVGIHGTKESAGFGFIGMVGPINA
    NCTC8325        SVFFGGVKMMIPNMVKYPILMLPILTTAIVSGLVSALVGIHGTKESAGFGFIGMVGPINA
    Newman          SVFFGGVKMMIPNMVKYPILMLPILTTAIVSGLVSALVGIHGTKESAGFGFIGMVGPINA
    USA300_FPR3757  SVFFGGVKMMIPNMVKYPILMLPILTTAIVSGLVSALVGIHGTKESAGFGFIGMVGPINA
                    ************************************************************

    COL             FKFMEVDSAWLSVLLIVVAFFVVPFVTAWLADIIYRKVFRLYTNDIFKFMG
    N315            FKFMEVDSAWLSVLLIVVAFFVVPFVTAWLADIIYRKVFRLYTNDIFKFMG
    NCTC8325        FKFMEVDSAWLSVLLIVVAFFVVPFVTAWLADIIYRKVFRLYTNDIFKFMG
    Newman          FKFMEVDSAWLSVLLIVVAFFVVPFVTAWLADIIYRKVFRLYTNDIFKFMG
    USA300_FPR3757  FKFMEVDSAWLSVLLIVVAFFVVPFVTAWLADIIYRKVFRLYTNDIFKFMG
                    ***************************************************