From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006249000
  • symbol?:
  • description?: nmrA-like family protein

      descriptions from strain specific annotations:

    • nmrA-like family protein
    • NAD dependent epimerase/dehydratase family protein
    • nucleoside-diphosphate-sugar epimerase
    • putative NmrA negative transcriptional regulator family protein
    • actVA 4 protein
    • NmrA family protein
  • strand?: -
  • coordinates?: 6308184..6308740
  • synteny block?: BlockID0049720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2514
    08BA02176:
    C248_2634
    11819-97:
    MS7_2582
    71193:
    ST398NM01_2626
    ECT-R 2:
    ECTR2_2430
    ED133:
    SAOV_2620c
    ED98:
    SAAV_2642
    HO 5096 0412:
    SAEMRSA15_24780
    JH1:
    SaurJH1_2652
    JH9:
    SaurJH9_2598
    JKD6008:
    SAA6008_02614 (nrmA)
    JKD6159:
    SAA6159_02473 (nrmA)
    LGA251:
    SARLGA251_23500
    M013:
    M013TW_2550
    MRSA252:
    SAR2656
    MSHR1132:
    SAMSHR1132_23910
    MSSA476:
    SAS2462
    Mu3:
    SAHV_2560
    Mu50:
    SAV2576
    MW2:
    MW2496
    RF122:
    SAB2449c
    ST398:
    SAPIG2626
    T0131:
    SAT0131_02787
    TCH60:
    HMPREF0772_10615
    TW20:
    SATW20_26960
    USA300_TCH1516:
    USA300HOU_2570
    VC40:
    SAVC_11755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDILVIGATGKQGNAVVKQLLEDGWYVSALTRNKNNRKLSDIGHPHLSIVEGDLSDNVS
    N315            MKDILVIGATGKQGNAVVKQLLEDGWYVSALTRNKNNRKLSDIGHPHLSIVEGDLSDNVS
    NCTC8325        MKDILVIGATGKQGNAVVKQLLEDGWYVSALTRNKNNRKLSDIGHPHLSIVEGDLSDNVS
    Newman          MKDILVIGATGKQGNAVVKQLLEDGWYVSALTRNKNNRKLSDIGHPHLSIVEGDLSDNVS
    USA300_FPR3757  MKDILVIGATGKQGNAVVKQLLEDGWYVSALTRNKNNRKLSDIGHPHLSIVEGDLSDNVS
                    ************************************************************

    COL             LQSAMKGKYGLYSIQPIVKDDVSEELRQGMKIIEIAEQENIQHIVYSTAGGVNRNRTGPH
    N315            LQSAMKGKYGLYSIQPIVKDDVSEELRQGMKIIEIAEQENIQHIVYSTAGGVNRNRTGPH
    NCTC8325        LQSAMKGKYGLYSIQPIVKDDVSEELRQGMKIIEIAEQENIQHIVYSTAGGVNRNRTGPH
    Newman          LQSAMKGKYGLYSIQPIVKDDVSEELRQGMKIIEIAEQENIQHIVYSTAGGVNRNRTGPH
    USA300_FPR3757  LQSAMKGKYGLYSIQPIVKDDVSEELRQGMKIIEIAEQENIQHIVYSTAGGVNRNRTGPH
                    ************************************************************

    COL             FEVLAKIENRLMESNINATVIKPSFFMDNFLRIAKVEDERITLPEFINPNIKFTMISSID
    N315            FEVLAKIENRLMESNINATVIKPSFFMDNFLRIAKVEDERITLPEFINPNIKFTMISSID
    NCTC8325        FEVLAKIENRLMESNINATVIKPSFFMDNFLRIAKVEDERITLPEFINPNIKFTMISSID
    Newman          FEVLAKIENRLMESNINATVIKPSFFMDNFLRIAKVEDERITLPEFINPNIKFTMISSID
    USA300_FPR3757  FEVLAKIENRLMESNINATVIKPSFFMDNFLRIAKVEDERITLPEFINPNIKFTMISSID
                    ************************************************************

    COL             IAKIASYIFAHPQSFTHQSIEIGSDEVTLSEAATIFSEVTGKSTVIEGEFVSGVAEKQWL
    N315            IAKIASYIFAHPQSFTHQSIEIGSDEVTLSEAATIFSEVTGKSTVIEGEFVSGVAEKQWL
    NCTC8325        IAKIASYIFAHPQSFTHQSIEIGSDEVTLSEAATIFSEVTGKSTVIEGEFVSGVAEKQWL
    Newman          IAKIASYIFAHPQSFTHQSIEIGSDEVTLSEAATIFSEVTGKSTVIEGEFVSGVAEKQWL
    USA300_FPR3757  IAKIASYIFAHPQSFTHQSIEIGSDEVTLSEAATIFSEVTGKSTVIEGEFVSGVAEKQWL
                    ************************************************************

    COL             EEKGYEVDFELMAEINPTRLSLSDWLKVQNYNK
    N315            EEKGYEVDFELMAEINPTRLSLSDWLKVQNYNK
    NCTC8325        EEKGYEVDFELMAEINPTRLSLSDWLKVQNYNK
    Newman          EEKGYEVDFELMAEINPTRLSLSDWLKVQNYNK
    USA300_FPR3757  EEKGYEVDFELMAEINPTRLSLSDWLKVQNYNK
                    *********************************