From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006257000
  • symbol?:
  • description?: alpha/beta hydrolase

      descriptions from strain specific annotations:

    • alpha/beta hydrolase
    • alpha/beta fold family hydrolase
    • hydrolase
    • hydrolase family protein
    • alpha/beta hydrolase fold family protein
    • hydrolase/acyltransferase
    • pseudogene
    • putative hydrolase/acyltransferase
  • strand?: +
  • coordinates?: 6311848..6312679
  • synteny block?: BlockID0049800
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2519
    08BA02176:
    11819-97:
    MS7_2587
    71193:
    ECT-R 2:
    ECTR2_2435
    ED133:
    SAOV_2626
    ED98:
    SAAV_2647
    HO 5096 0412:
    JH1:
    SaurJH1_2657
    JH9:
    SaurJH9_2603
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_23550
    M013:
    M013TW_2555
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2467
    Mu3:
    SAHV_2565
    Mu50:
    SAV2581
    MW2:
    MW2501
    RF122:
    SAB2455
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_27010
    USA300_TCH1516:
    USA300HOU_2575
    VC40:
    SAVC_11780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESE
    N315            METLELQGAKLRYHQVGQGPVLIFIPGANGTGNIFLPLAEQLKDHFTVVAVDRRDYGESE
    NCTC8325        METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESE
    Newman          METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESE
    USA300_FPR3757  METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESE
                    ********************************:***************************

    COL             LTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVV
    N315            LTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVV
    NCTC8325        LTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVV
    Newman          LTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVV
    USA300_FPR3757  LTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVV
                    ************************************************************

    COL             KKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQP
    N315            KKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQP
    NCTC8325        KKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQP
    Newman          KKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQP
    USA300_FPR3757  KKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQP
                    ************************************************************

    COL             ADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNF
    N315            ADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNF
    NCTC8325        ADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNF
    Newman          ADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNF
    USA300_FPR3757  ADTEEGRIEQYKRTMFWLEFEIRQYTHSNITLDDFTKYSDKITLLNGTDSRGSFPQDVNF
                    ***************** **********:*******************************

    COL             YINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG
    N315            YINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG
    NCTC8325        YINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG
    Newman          YINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG
    USA300_FPR3757  YINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG
                    ************************************