From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006265000
  • symbol?:
  • description?: conserved cytoplasmic protein
  • strand?: -
  • coordinates?: 6318505..6318843
  • synteny block?: BlockID0049880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2524
    08BA02176:
    C248_2646
    11819-97:
    MS7_2592
    71193:
    ST398NM01_2636
    ECT-R 2:
    ECTR2_2440
    ED133:
    SAOV_2631c
    ED98:
    SAAV_2652
    HO 5096 0412:
    SAEMRSA15_24890
    JH1:
    SaurJH1_2662
    JH9:
    SaurJH9_2608
    JKD6008:
    SAA6008_02645
    JKD6159:
    SAA6159_02483
    LGA251:
    SARLGA251_23600
    M013:
    M013TW_2560
    MRSA252:
    SAR2666
    MSHR1132:
    SAMSHR1132_24010
    MSSA476:
    SAS2472
    Mu3:
    SAHV_2570
    Mu50:
    SAV2586
    MW2:
    MW2506
    RF122:
    SAB2461c
    ST398:
    SAPIG2636
    T0131:
    SAT0131_02820
    TCH60:
    HMPREF0772_10605
    TW20:
    SATW20_27270
    USA300_TCH1516:
    USA300HOU_2580
    VC40:
    SAVC_11810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMA
    N315            MSNKLDGINKMITAKHKQMDDLYDEKREVKALIDESDELNHSIEQLYQHLGDRYHSSNMA
    NCTC8325        MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMA
    Newman          MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMA
    USA300_FPR3757  MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMA
                    ****** ***:*****:******************** *****:*******:**:*****

    COL             SRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKW
    N315            SRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKAEEEMIDLEMRRNVEIETVTKEENKW
    NCTC8325        SRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKW
    Newman          SRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKW
    USA300_FPR3757  SRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKW
                    **********************************.*************************

    COL             KQ
    N315            KQ
    NCTC8325        KQ
    Newman          KQ
    USA300_FPR3757  KQ
                    **