Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006274000
  • symbol?:
  • description?: PhnB protein

      descriptions from strain specific annotations:

    • PhnB protein
    • putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein
    • 3-demethylubiquinone-9 3-methyltransferase domain protein, putative
    • Phnb
  • strand?: +
  • coordinates?: 6325364..6325822
  • synteny block?: BlockID0049970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2530 (phnB)
    08BA02176:
    C248_2653
    11819-97:
    MS7_2598
    71193:
    ST398NM01_2642
    ECT-R 2:
    ECTR2_2446
    ED133:
    SAOV_2637
    ED98:
    SAAV_2658
    HO 5096 0412:
    SAEMRSA15_24950
    JH1:
    SaurJH1_2668
    JH9:
    SaurJH9_2614
    JKD6008:
    SAA6008_02651
    JKD6159:
    SAA6159_02489
    LGA251:
    SARLGA251_23660
    M013:
    M013TW_2566
    MRSA252:
    SAR2672
    MSHR1132:
    SAMSHR1132_24080
    MSSA476:
    SAS2478
    Mu3:
    SAHV_2576
    Mu50:
    SAV2592
    MW2:
    MW2512
    RF122:
    SAB2467
    ST398:
    SAPIG2642
    T0131:
    SAT0131_02826 (hisD)
    TCH60:
    HMPREF0772_10599
    TW20:
    SATW20_27330
    USA300_TCH1516:
    USA300HOU_2587
    VC40:
    SAVC_11840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
    N315            MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
    NCTC8325        MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
    Newman          MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
    USA300_FPR3757  MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
                    ************************************************************

    COL             LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
    N315            LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEKIKDHSSIEIELPFADQ
    NCTC8325        LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
    Newman          LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
    USA300_FPR3757  LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
                    *******************************************:****************

    COL             FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ
    N315            FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ
    NCTC8325        FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ
    Newman          FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ
    USA300_FPR3757  FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ
                    *****************************