From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006322000
  • symbol?: nrdD
  • description?: anaerobic ribonucleoside triphosphate reductase

      descriptions from strain specific annotations:

    • anaerobic ribonucleoside triphosphate reductase
    • Ribonucleotide reductase of class III (anaerobic), large subunit
    • anaerobic ribonucleoside-triphosphate reductase large subunit
    • anaerobic ribonucleotide reductase, large subunit
    • anaerobic ribonucleotide reductase large subunit
  • strand?: -
  • coordinates?: 6364991..6366841
  • synteny block?: BlockID0050380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2635 (nrdD)
    N315:
    SA2410 (nrdD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2555 (nrdD)
    08BA02176:
    C248_2679 (nrdD)
    11819-97:
    MS7_2622 (nrdD)
    71193:
    ST398NM01_2664
    ECT-R 2:
    ECTR2_2471 (nrdD)
    ED133:
    SAOV_2663c
    ED98:
    SAAV_2683 (nrdD)
    HO 5096 0412:
    SAEMRSA15_25210 (nrdD)
    JH1:
    SaurJH1_2694
    JH9:
    SaurJH9_2640
    JKD6008:
    SAA6008_02674 (nrdD)
    JKD6159:
    SAA6159_02513 (nrdD)
    LGA251:
    SARLGA251_23890 (nrdD)
    M013:
    M013TW_2595
    MRSA252:
    SAR2695 (nrdD)
    MSHR1132:
    SAMSHR1132_24330
    MSSA476:
    SAS2503
    Mu3:
    SAHV_2601 (nrdD)
    Mu50:
    SAV2617 (nrdD)
    MW2:
    MW2537 (nrdD)
    RF122:
    SAB2491c (nrdD)
    ST398:
    SAPIG2664 (nrdD)
    T0131:
    SAT0131_02850
    TCH60:
    HMPREF0772_10573 (nrdD)
    TW20:
    SATW20_27550 (nrdD)
    USA300_TCH1516:
    USA300HOU_2614 (nrdD)
    VC40:
    SAVC_11950

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQIEEALTGLISKDPAIVNENANKDSDTFSTMRDLTAGIVSKSYALNHLLPKHVADAHQ
    N315            MNQIEEALTGLISKDPAIVNENANKDSDTFSTMRDLTAGIVSKSYALNYLLPKHVADAHQ
    NCTC8325        MNQIEEALTGLISKDPAIVNENANKDSDTFSTMRDLTAGIVSKSYALNHLLPKHVADAHQ
    Newman          MNQIEEALTGLISKDPAIVNENANKDSDTFSTMRDLTAGIVSKSYALNHLLPKHVADAHQ
    USA300_FPR3757  MNQIEEALTGLISKDPAIVNENANKDSDTFSTMRDLTAGIVSKSYALNHLLPKHVADAHQ
                    ************************************************:***********

    COL             RGDIHFHDLDYHPFQPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANV
    N315            RGDIHFHDLDYHPFQPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANV
    NCTC8325        RGDIHFHDLDYHPFQPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANV
    Newman          RGDIHFHDLDYHPFQPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANV
    USA300_FPR3757  RGDIHFHDLDYHPFQPLTNCCLIDAKNMLHNGFEIGNANVTSPKSIQTASAQLVQIIANV
                    ************************************************************

    COL             SSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEIDRYVDQQVTKDINDAIESL
    N315            SSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEIDRYVDQQVTKDINDAIESL
    NCTC8325        SSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEIDRYVDQQVTKDINDAIESL
    Newman          SSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEIDRYVDQQVTKDINDAIESL
    USA300_FPR3757  SSSQYGGCTVDRVDELLSTYARHNEEQHRNIAKQFVKESEIDRYVDQQVTKDINDAIESL
                    ************************************************************

    COL             EYEINTLYTSNGQTPFVTLGFGLGTDHLSRKIQQAILNTRIKGLGKDRTTAIFPKLVFSI
    N315            EYEINTLYTSNGQTPFVTLGFGLGTDHLSRKIQQAILNTRIKGLGKDRTTAIFPKLVFSI
    NCTC8325        EYEINTLYTSNGQTPFVTLGFGLGTDHLSRKIQQAILNTRIKGLGKDRTTAIFPKLVFSI
    Newman          EYEINTLYTSNGQTPFVTLGFGLGTDHLSRKIQQAILNTRIKGLGKDRTTAIFPKLVFSI
    USA300_FPR3757  EYEINTLYTSNGQTPFVTLGFGLGTDHLSRKIQQAILNTRIKGLGKDRTTAIFPKLVFSI
                    ************************************************************

    COL             KKGTNFSPQDPNYDIKQLALKCSTKRMYPDILNYDKLVEILGDFKAPMGCRSFLPSWKDA
    N315            KKGTNFSPQDPNYDIKQLALKCSTKRMYPDILNYDKLVEILGDFKAPMGCRSFLPSWKDA
    NCTC8325        KKGTNFSPQDPNYDIKQLALKCSTKRMYPDILNYDKLVEILGDFKAPMGCRSFLPSWKDA
    Newman          KKGTNFSPQDPNYDIKQLALKCSTKRMYPDILNYDKLVEILGDFKAPMGCRSFLPSWKDA
    USA300_FPR3757  KKGTNFSPQDPNYDIKQLALKCSTKRMYPDILNYDKLVEILGDFKAPMGCRSFLPSWKDA
                    ************************************************************

    COL             EGHFENNGRCNLGVVTLNLPRMALESAGNMTKFWEIFYERIDVLHDALLYRINRLKDAVP
    N315            EGHFENNGRCNLGVVTLNLPRMALESAGNMTKFWEIFYERIDVLHDALLYRINRLKDAVP
    NCTC8325        EGHFENNGRCNLGVVTLNLPRMALESAGNMTKFWEIFYERIDVLHDALLYRINRLKDAVP
    Newman          EGHFENNGRCNLGVVTLNLPRMALESAGNMTKFWEIFYERIDVLHDALLYRINRLKDAVP
    USA300_FPR3757  EGHFENNGRCNLGVVTLNLPRMALESAGNMTKFWEIFYERIDVLHDALLYRINRLKDAVP
                    ************************************************************

    COL             NNAPILYKSGAFNYKLKETDDVAELFKNKRATISMGYIGLYETATVFYGPDWETSQEAKA
    N315            NNAPILYKSGAFNYKLKETDDVAELFKNKRATISMGYIGLYETATVFYGPDWETSQEAKA
    NCTC8325        NNAPILYKSGAFNYKLKETDDVAELFKNKRATISMGYIGLYETATVFYGPDWETSQEAKA
    Newman          NNAPILYKSGAFNYKLKETDDVAELFKNKRATISMGYIGLYETATVFYGPDWETSQEAKA
    USA300_FPR3757  NNAPILYKSGAFNYKLKETDDVAELFKNKRATISMGYIGLYETATVFYGPDWETSQEAKA
                    ************************************************************

    COL             FTLEILKEMKRYQTKWTELYDIWFSIYSTPSESLTDRFCRLDQERFGDIKDITDKGYYQN
    N315            FTLEILKEMKRYQTKWTELYDIWFSIYSTPSESLTDRFCRLDQERFGDIKDITDKGYYQN
    NCTC8325        FTLEILKEMKRYQTKWTELYDIWFSIYSTPSESLTDRFCRLDQERFGDIKDITDKGYYQN
    Newman          FTLEILKEMKRYQTKWTELYDIWFSIYSTPSESLTDRFCRLDQERFGDIKDITDKGYYQN
    USA300_FPR3757  FTLEILKEMKRYQTKWTELYDIWFSIYSTPSESLTDRFCRLDQERFGDIKDITDKGYYQN
                    ************************************************************

    COL             SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLQHNLKALEAVWDYSYDKVGYL
    N315            SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLQHNLKALEAVWDYSYDKVGYL
    NCTC8325        SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLQHNLKALEAVWDYSYDKVGYL
    Newman          SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLQHNLKALEAVWDYSYDKVGYL
    USA300_FPR3757  SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLQHNLKALEAVWDYSYDKVGYL
                    ************************************************************

    COL             GTNIPIDHCYECDYDGDFEATEKGFKCPNCGNDNPKTVDVVKRTCGYLGNPVQRPVIKGR
    N315            GTNIPIDHCYECDYDGDFEATEKGFKCPNCGNDNPKTVDVVKRTCGYLGNPVQRPVIKGR
    NCTC8325        GTNIPIDHCYECDYDGDFEATEKGFKCPNCGNDNPKTVDVVKRTCGYLGNPVQRPVIKGR
    Newman          GTNIPIDHCYECDYDGDFEATEKGFKCPNCGNDNPKTVDVVKRTCGYLGNPVQRPVIKGR
    USA300_FPR3757  GTNIPIDHCYECDYDGDFEATEKGFKCPNCGNDNPKTVDVVKRTCGYLGNPVQRPVIKGR
                    ************************************************************

    COL             HKEICARVKHMKAPKE
    N315            HKEICARVKHMKAPKE
    NCTC8325        HKEICARVKHMKAPKE
    Newman          HKEICARVKHMKAPKE
    USA300_FPR3757  HKEICARVKHMKAPKE
                    ****************