From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006338000
  • symbol?: nsaR
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • nisin susceptibility-associated DNA-binding response regulator
    • response regulator protein
    • response regulator receiver
    • response regulator receiver domain/transcriptional regulatory protein
    • two-component response regulator
    • Two-component response regulator YvcP
    • two-component sensor response regulator
    • two component transcriptional regulator
    • Two component transcriptional regulator, winged helix family
    • winged helix family two component transcriptional regulator
  • strand?: -
  • coordinates?: 6379205..6379871
  • synteny block?: BlockID0050540
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2564 (yvcP)
    08BA02176:
    C248_2692
    11819-97:
    MS7_2630
    71193:
    ST398NM01_2674
    ECT-R 2:
    ECTR2_2479
    ED133:
    SAOV_2673c
    ED98:
    SAAV_2693
    HO 5096 0412:
    SAEMRSA15_25290
    JH1:
    SaurJH1_2704
    JH9:
    SaurJH9_2648
    JKD6008:
    SAA6008_02684
    JKD6159:
    SAA6159_02521
    LGA251:
    SARLGA251_23970
    M013:
    M013TW_2604
    MRSA252:
    SAR2703
    MSHR1132:
    SAMSHR1132_24410
    MSSA476:
    SAS2511
    Mu3:
    SAHV_2609
    Mu50:
    SAV2625
    MW2:
    MW2545
    RF122:
    SAB2500c
    ST398:
    SAPIG2674
    T0131:
    SAT0131_02888
    TCH60:
    HMPREF0772_10564
    TW20:
    SATW20_27630
    USA300_TCH1516:
    USA300HOU_2624
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQNQPQLVLLDINLPTLNGF
    N315            MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQHQPQLVLLDINLPTLNGF
    NCTC8325        MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQNQPQLVLLDINLPTLNGF
    Newman          MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQNQPQLVLLDINLPTLNGF
    USA300_FPR3757  MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQNQPQLVLLDINLPTLNGF
                    ******************************************:*****************

    COL             HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
    N315            HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
    NCTC8325        HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
    Newman          HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
    USA300_FPR3757  HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
                    ************************************************************

    COL             LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
    N315            LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
    NCTC8325        LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
    Newman          LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
    USA300_FPR3757  LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
                    ************************************************************

    COL             ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
    N315            ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
    NCTC8325        ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
    Newman          ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
    USA300_FPR3757  ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
                    *****************************************