From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006340000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 6379897..6380086
  • synteny block?: BlockID0050560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2565
    08BA02176:
    C248_2693
    11819-97:
    MS7_2631
    71193:
    ST398NM01_2675
    ECT-R 2:
    ECTR2_2480
    ED133:
    SAOV_2674c
    ED98:
    SAAV_2694
    HO 5096 0412:
    SAEMRSA15_25300
    JH1:
    SaurJH1_2705
    JH9:
    SaurJH9_2649
    JKD6008:
    SAA6008_02685
    JKD6159:
    SAA6159_02522
    LGA251:
    SARLGA251_23980
    M013:
    M013TW_2605
    MRSA252:
    SAR2704
    MSHR1132:
    SAMSHR1132_24420
    MSSA476:
    SAS2512
    Mu3:
    SAHV_2610
    Mu50:
    SAV2626
    MW2:
    MW2546
    RF122:
    SAB2501c
    ST398:
    SAPIG2675
    T0131:
    SAT0131_02889
    TCH60:
    HMPREF0772_10563
    TW20:
    SATW20_27640
    USA300_TCH1516:
    USA300HOU_2625
    VC40:
    SAVC_12005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKE
    N315            MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQTKE
    NCTC8325        MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKE
    Newman          MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKE
    USA300_FPR3757  MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKE
                    ********************************************************* **

    COL             QKDNKG
    N315            QKDNKG
    NCTC8325        QKDNKG
    Newman          QKDNKG
    USA300_FPR3757  QKDNKG
                    ******