From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006366000
  • symbol?: argR
  • description?: arginine repressor ArgR

      descriptions from strain specific annotations:

    • arginine repressor ArgR
    • ArgR family transcriptional regulator
    • Arginine pathway regulatory protein ArgR, repressor of arg regulon
    • arginine repressor, C-terminal domain protein
    • arginine repressor family protein
    • ArgR family transcription regulator
    • arginine repressor, DNA binding domain protein
  • strand?: -
  • coordinates?: 6400538..6400987
  • synteny block?: BlockID0050750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2535 (argR)
    USA300_FPR3757:
    04-02981:
    SA2981_2575 (argR)
    08BA02176:
    C248_2704
    11819-97:
    MS7_2641
    71193:
    ST398NM01_2686
    ECT-R 2:
    ECTR2_2490
    ED133:
    SAOV_2685c
    ED98:
    SAAV_2705
    HO 5096 0412:
    SAEMRSA15_25410
    JH1:
    SaurJH1_2716
    JH9:
    SaurJH9_2660
    JKD6008:
    SAA6008_02695 (argR)
    JKD6159:
    SAA6159_02532 (argR)
    LGA251:
    SARLGA251_24080
    M013:
    M013TW_2617
    MRSA252:
    SAR2715
    MSHR1132:
    SAMSHR1132_24600
    MSSA476:
    SAS2522
    Mu3:
    SAHV_2620
    Mu50:
    SAV2636
    MW2:
    MW2557
    RF122:
    SAB2511c (argR)
    ST398:
    SAPIG2686
    T0131:
    SAT0131_02902
    TCH60:
    HMPREF0772_10551
    TW20:
    SATW20_27740
    USA300_TCH1516:
    USA300HOU_2636 (argR3)
    VC40:
    SAVC_12060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKSKRLEIVSTIVKKHKIYKKEQIISYIEEYFGVRYSATTIAKDLKELNIYRVPIDCET
    N315            MKKSKRLEIVSTIVKKHKIYKKEQIISYIEEYFGVRYSATTIAKDLKELNIYRVPIDCET
    NCTC8325        MKKSKRLEIVSTIVKKHKIYKKEQIISYIEEYFGVRYSATTIAKDLKELNIYRVPIDCET
    Newman          MKKSKRLEIVSTIVKKHKIYKKEQIISYIEEYFGVRYSATTIAKDLKELNIYRVPIDCET
    USA300_FPR3757  MKKSKRLEIVSTIVKKHKIYKKEQIISYIEEYFGVRYSATTIAKDLKELNIYRVPIDCET
                    ************************************************************

    COL             WIYKAINNQTEQEMREKFRHYCEHEVLSSIINGSYIIVKTSPGFAQGINYFIDQLNIEEI
    N315            WIYKAINNQTEQEMREKFRHYCEHEVLSSIINGSYIIVKTSPGFAQGINYFIDQLNIEEI
    NCTC8325        WIYKAINNQTEQEMREKFRHYCEHEVLSSIINGSYIIVKTSPGFAQGINYFIDQLNIEEI
    Newman          WIYKAINNQTEQEMREKFRHYCEHEVLSSIINGSYIIVKTSPGFAQGINYFIDQLNIEEI
    USA300_FPR3757  WIYKAINNQTEQEMREKFRHYCEHEVLSSIINGSYIIVKTSPGFAQGINYFIDQLNIEEI
                    ************************************************************

    COL             LGTVSGNDTTLILTASNDMAEYVYAKLFK
    N315            LGTVSGNDTTLILTASNDMAEYVYAKLFK
    NCTC8325        LGTVSGNDTTLILTASNDMAEYVYAKLFK
    Newman          LGTVSGNDTTLILTASNDMAEYVYAKLFK
    USA300_FPR3757  LGTVSGNDTTLILTASNDMAEYVYAKLFK
                    *****************************