From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006369000
  • symbol?: isaB
  • description?: immunodominant antigen B

      descriptions from strain specific annotations:

    • immunodominant antigen B
    • immunodominant staphylococcal antigen B
  • strand?: -
  • coordinates?: 6404849..6405376
  • synteny block?: BlockID0050780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2660 (isaB)
    N315:
    SA2431 (isaB)
    NCTC8325:
    Newman:
    NWMN_2537 (isaB)
    USA300_FPR3757:
    04-02981:
    SA2981_2577 (isaB)
    08BA02176:
    C248_2706 (isaB)
    11819-97:
    MS7_2643 (isaB)
    71193:
    ST398NM01_2688
    ECT-R 2:
    ECTR2_2492
    ED133:
    SAOV_2687c
    ED98:
    SAAV_2708 (isaB)
    HO 5096 0412:
    SAEMRSA15_25430 (isaB)
    JH1:
    SaurJH1_2718
    JH9:
    SaurJH9_2662
    JKD6008:
    SAA6008_02697 (isaB)
    JKD6159:
    SAA6159_02534 (isaB)
    LGA251:
    SARLGA251_24100 (isaB)
    M013:
    M013TW_2619
    MRSA252:
    SAR2717 (isaB)
    MSHR1132:
    SAMSHR1132_24620
    MSSA476:
    SAS2524
    Mu3:
    SAHV_2622 (isaB)
    Mu50:
    SAV2638 (isaB)
    MW2:
    MW2559 (isaB)
    RF122:
    SAB2513c (isaB)
    ST398:
    SAPIG2688
    T0131:
    SAT0131_02904
    TCH60:
    HMPREF0772_10549 (isaB)
    TW20:
    SATW20_27760 (isaB)
    USA300_TCH1516:
    USA300HOU_2638 (isaB)
    VC40:
    SAVC_12070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNF
    N315            MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNF
    NCTC8325        MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNF
    Newman          MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNF
    USA300_FPR3757  MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNF
                    ************************************************************

    COL             INAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQK
    N315            INAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQK
    NCTC8325        INAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQK
    Newman          INAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQK
    USA300_FPR3757  INAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQK
                    ************************************************************

    COL             AYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK
    N315            AYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK
    NCTC8325        AYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK
    Newman          AYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK
    USA300_FPR3757  AYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK
                    *******************************************************