From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006371000
  • symbol?:
  • description?: PTS mannose transporter subunit IIA

      descriptions from strain specific annotations:

    • PTS mannose transporter subunit IIA
    • BglG family transcriptional antiterminator
    • transcriptional antiterminator BglG family protein
    • Activator of the mannose operon (transcriptional antiterminator), BglG family
    • transcription antiterminator, BglG family
    • antiterminator transcriptional regulator
    • BglG family transcription antiterminator
    • deoR-like helix-turn-helix domain protein
    • PRD domain-containing protein
    • transcriptional antiterminator BglG
    • transcriptional regulator
  • strand?: +
  • coordinates?: 6406819..6408693
  • synteny block?: BlockID0050800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2579
    08BA02176:
    C248_2708
    11819-97:
    MS7_2645
    71193:
    ST398NM01_2690
    ECT-R 2:
    ECTR2_2494
    ED133:
    SAOV_2689
    ED98:
    SAAV_2710
    HO 5096 0412:
    SAEMRSA15_25450
    JH1:
    SaurJH1_2720
    JH9:
    SaurJH9_2664
    JKD6008:
    SAA6008_02699
    JKD6159:
    SAA6159_02536
    LGA251:
    SARLGA251_24120
    M013:
    M013TW_2621
    MRSA252:
    SAR2719
    MSHR1132:
    SAMSHR1132_24640
    MSSA476:
    SAS2526
    Mu3:
    SAHV_2624
    Mu50:
    SAV2640
    MW2:
    MW2561
    RF122:
    SAB2515
    ST398:
    SAPIG2690
    T0131:
    SAT0131_02906
    TCH60:
    HMPREF0772_10547
    TW20:
    SATW20_27780
    USA300_TCH1516:
    USA300HOU_2640
    VC40:
    SAVC_12080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLDRHLKLLQFFIKNPSKHISSNEIAKHVNVSNRTVRNDIHVINSNFMDDIIVSIKSKGY
    N315            MLDRHLKLLQFFIKNPSKHISSNEIAEHVNVSNRTVRNDIHVINSNFMDDIIVSIKSKGY
    NCTC8325        MLDRHLKLLQFFIKNPSKHISSNEIAKHVNVSNRTVRNDIHVINSNFMDDIIVSIKSKGY
    Newman          MLDRHLKLLQFFIKNPSKHISSNEIAKHVNVSNRTVRNDIHVINSNFMDDIIVSIKSKGY
    USA300_FPR3757  MLDRHLKLLQFFIKNPSKHISSNEIAKHVNVSNRTVRNDIHVINSNFMDDIIVSIKSKGY
                    **************************:*********************************

    COL             QLNTSQYTLETITERYTHIQSYKEKLLLSMAYQLLMHNKSQTLQQLEQDYLLSKTVLNDY
    N315            QLNTSQYTLETITERYTHIQSYKEKLLLSMAYQLLMHNKSQTLQQLEQDYLLSKTVLNDY
    NCTC8325        QLNTSQYTLETITERYTHIQSYKEKLLLSMAYQLLMHNKSQTLQQLEQDYLLSKTVLNDY
    Newman          QLNTSQYTLETITERYTHIQSYKEKLLLSMAYQLLMHNKSQTLQQLEQDYLLSKTVLNDY
    USA300_FPR3757  QLNTSQYTLETITERYTHIQSYKEKLLLSMAYQLLMHNKSQTLQQLEQDYLLSKTVLNDY
                    ************************************************************

    COL             FVRIQQWCQKFNIALTIKKKQGIVVDGTDNDITNAIIHLNQLSSGHVHVEDLILNELPDS
    N315            FVRIQQWCQKFNIVLTIKKKQGIVVDGTDNDITNAIIHLNQLSSGHVHVEDLILNELPDS
    NCTC8325        FVRIQQWCQKFNIALTIKKKQGIVVDGTDNDITNAIIHLNQLSSGHVHVEDLILNELPDS
    Newman          FVRIQQWCQKFNIALTIKKKQGIVVDGTDNDITNAIIHLNQLSSGHVHVEDLILNELPDS
    USA300_FPR3757  FVRIQQWCQKFNIALTIKKKQGIVVDGTDNDITNAIIHLNQLSSGHVHVEDLILNELPDS
                    *************.**********************************************

    COL             HQRMISHIIQETLQQHSIETTDIQIQQLLIHLILIIKRKQSLSELDTLNHDSKLISQSCI
    N315            HQRMISHIIQETLQQHSIETTDIQIQQLLIHLILIIKRKQSLSELDTLNHDAKLISQSCI
    NCTC8325        HQRMISHIIQETLQQHSIETTDIQIQQLLIHLILIIKRKQSLSELDTLNHDSKLISQSCI
    Newman          HQRMISHIIQETLQQHSIETTDIQIQQLLIHLILIIKRKQSLSELDTLNHDSKLISQSCI
    USA300_FPR3757  HQRMISHIIQETLQQHSIETTDIQIQQLLIHLILIIKRKQSLSELDTLNHDSKLISQSCI
                    ***************************************************:********

    COL             KQINERLGYDLNEKVINMFSFFIAYHFNKLDIGIERIFIQSYIDRLIELMQQRIHVPFNE
    N315            KQINERLGYDLNEKVINMFSFFIAYHFNKLDIGIERIFIQSYIDRLIELMQQRIHVPFNE
    NCTC8325        KQINERLGYDLNEKVINMFSFFIAYHFNKLDIGIERIFIQSYIDRLIELMQQRIHVPFNE
    Newman          KQINERLGYDLNEKVINMFSFFIAYHFNKLDIGIERIFIQSYIDRLIELMQQRIHVPFNE
    USA300_FPR3757  KQINERLGYDLNEKVINMFSFFIAYHFNKLDIGIERIFIQSYIDRLIELMQQRIHVPFNE
                    ************************************************************

    COL             DSILQQNLYNHFSKAYLRITQNIYLNNPLVIEIKKLYPFVFNTLFEAIDKLAIDTDIEMS
    N315            DSILQQNLYNHFSKAYLRITQNIYLNNPLVIEIKKLYPFVFNTLFEAIDKLAIDTDIEMS
    NCTC8325        DSILQQNLYNHFSKAYLRITQNIYLNNPLVIEIKKLYPFVFNTLFEAIDKLAIDTDIEMS
    Newman          DSILQQNLYNHFSKAYLRITQNIYLNNPLVIEIKKLYPFVFNTLFEAIDKLAIDTDIEMS
    USA300_FPR3757  DSILQQNLYNHFSKAYLRITQNIYLNNPLVIEIKKLYPFVFNTLFEAIDKLAIDTDIEMS
                    ************************************************************

    COL             EDEIAFLTIHFQAAIERRTKTQLNVVIACYYGLGVSNFLETKINNLSEELSVINTIKLEN
    N315            EDEIAFLTIHFQAAIERRTKTQLNVVIACYYGLGVSNFLETKINNLSEELSVINTIKLES
    NCTC8325        EDEIAFLTIHFQAAIERRTKTQLNVVIACYYGLGVSNFLETKINNLSEELSVINTIKLEN
    Newman          EDEIAFLTIHFQAAIERRTKTQLNVVIACYYGLGVSNFLETKINNLSEELSVINTIKLEN
    USA300_FPR3757  EDEIAFLTIHFQAAIERRTKTQLNVVIACYYGLGVSNFLETKINNLSEELSVINTIKLEN
                    ***********************************************************.

    COL             ITHYHFDNVDLLITTHDIPKQTLNILPKHLTTIKVAPLFSEDDRHKIRHVVKQKQNPVQA
    N315            ITHYHFDNVDLLITTHDIPKQTLNILPKHLTTIKVAPLFSEDDRHKIRHVVKQKQNPVQA
    NCTC8325        ITHYHFDNVDLLITTHDIPKQTLNILPKHLTTIKVAPLFSEDDRHKIRHVVKQKQNPVQA
    Newman          ITHYHFDNVDLLITTHDIPKQTLNILPKHLTTIKVAPLFSEDDRHKIRHVVKQKQNPVQA
    USA300_FPR3757  ITHYHFDNVDLLITTHDIPKQTLNILPKHLTTIKVAPLFSEDDRHKIRHVVKQKQNPVQA
                    ************************************************************

    COL             HHHMDTVNFLVVNTEQKSRHTVQIFEEAQKILQAHHAIVEGYIESALEREKSSSTYIGNF
    N315            HHHMDTVNFLVVNTEQKSRHTVQIFEEAQKILQAHHAIVEGYIESALEREKSSSTYIGNF
    NCTC8325        HHHMDTVNFLVVNTEQKSRHTVQIFEEAQKILQAHHAIVEGYIESALEREKSSSTYIGNF
    Newman          HHHMDTVNFLVVNTEQKSRHTVQIFEEAQKILQAHHAIVEGYIESALEREKSSSTYIGNF
    USA300_FPR3757  HHHMDTVNFLVVNTEQKSRHTVQIFEEAQKILQAHHAIVEGYIESALEREKSSSTYIGNF
                    ************************************************************

    COL             MAIPHGDPEKVLQSHVLIFRTKDVFPWRQHDVKLVFFLAISHKDKAFTKQMMQLIANLDD
    N315            MAIPHGDPEKVLQSHVLIFRTKDVFPWRQHDVKLVFFLAISHKDKAFTKQMMQLIANLDD
    NCTC8325        MAIPHGDPEKVLQSHVLIFRTKDVFPWRQHDVKLVFFLAISHKDKAFTKQMMQLIANLDD
    Newman          MAIPHGDPEKVLQSHVLIFRTKDVFPWRQHDVKLVFFLAISHKDKAFTKQMMQLIANLDD
    USA300_FPR3757  MAIPHGDPEKVLQSHVLIFRTKDVFPWRQHDVKLVFFLAISHKDKAFTKQMMQLIANLDD
                    ************************************************************

    COL             DSVNHLCSLDDHSLKQQLFEYLQE
    N315            DSVNHLCSLDDHSLKQQLFEYLQE
    NCTC8325        DSVNHLCSLDDHSLKQQLFEYLQE
    Newman          DSVNHLCSLDDHSLKQQLFEYLQE
    USA300_FPR3757  DSVNHLCSLDDHSLKQQLFEYLQE
                    ************************