From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006375000
  • symbol?:
  • description?: N-acetylmuramoyl-L-alanine amidase

      descriptions from strain specific annotations:

    • N-acetylmuramoyl-L-alanine amidase
    • exported protein
    • mannosyl-glycoendo-beta-N-acetylglucosaminidase family protein
    • mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase family protein
    • N-acetylmuramidase
    • N-acetylmuramoyl-L-alanine amidase, family 4
    • N-acetylmuramoyl-L-alanine amidase domain-containing protein
    • N-acetylmuramoyl-L-alanine amidase family protein
  • strand?: +
  • coordinates?: 6415000..6416883
  • synteny block?: BlockID0050840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2583
    08BA02176:
    C248_2712
    11819-97:
    MS7_2649
    71193:
    ST398NM01_2694
    ECT-R 2:
    ECTR2_2498
    ED133:
    SAOV_2693
    ED98:
    SAAV_2714
    HO 5096 0412:
    SAEMRSA15_25490
    JH1:
    SaurJH1_2724
    JH9:
    SaurJH9_2668
    JKD6008:
    SAA6008_02703
    JKD6159:
    SAA6159_02540
    LGA251:
    SARLGA251_24160
    M013:
    M013TW_2625
    MRSA252:
    SAR2723
    MSHR1132:
    SAMSHR1132_24680
    MSSA476:
    SAS2530
    Mu3:
    SAHV_2628
    Mu50:
    SAV2644
    MW2:
    MW2565
    RF122:
    SAB2519
    ST398:
    SAPIG2694
    T0131:
    SAT0131_02912
    TCH60:
    HMPREF0772_10543
    TW20:
    SATW20_27820
    USA300_TCH1516:
    USA300HOU_2644
    VC40:
    SAVC_12100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPKNKILIYLLSTTLVLPTLVSPTAYADTPQKDTTAKTTSHDSKKSNDDETSKDTTSKDI
    N315            MPKNKILIYLLSTTLVLPTLVSPTAYADTPQKDTTAKTTSHDSKKSNDDETSKDTTSKDT
    NCTC8325        MPKNKILIYLLSTTLVLPTLVSPTAYADTPQKDTTAKTTSHDSKKSNDDETSKDTTSKDI
    Newman          MPKNKILIYLLSTTLVLPTLVSPTAYADTPQKDTTAKTTSHDSKKSNDDETSKDTTSKDI
    USA300_FPR3757  MPKNKILIYLLSTTLVLPTLVSPTAYADTPQKDTTAKTTSHDSKKSNDDETSKDTTSKDI
                    *********************************************************** 

    COL             DKADKNNTSNQDNNDKKFKTIDDSTSDSNNIIDFIYKNLPQTNINQLLTKNKYDDNYSLT
    N315            DKADNNNTSNQDNNDKKFKTIDDSTSDSNNIIDFIYKNLPQTNINQLLTKNKYDDNYSLT
    NCTC8325        DKADKNNTSNQDNNDKKFKTIDDSTSDSNNIIDFIYKNLPQTNINQLLTKNKYDDNYSLT
    Newman          DKADKNNTSNQDNNDKKFKTIDDSTSDSNNIIDFIYKNLPQTNINQLLTKNKYDDNYSLT
    USA300_FPR3757  DKADKNNTSNQDNNDKKFKTIDDSTSDSNNIIDFIYKNLPQTNINQLLTKNKYDDNYSLT
                    ****:*******************************************************

    COL             TLIQNLFNLNSDISDYEQPRNGEKSTNDSNKNSDNSIKNDTDTQSSKQDKADNQKAPKSN
    N315            TLIQNLFNLNSDISDYEQPRNGEKSTNDSNKNSDNSIKNDTDTQSSKQDKADNQKAPKSN
    NCTC8325        TLIQNLFNLNSDISDYEQPRNGEKSTNDSNKNSDNSIKNDTDTQSSKQDKADNQKAPKSN
    Newman          TLIQNLFNLNSDISDYEQPRNGEKSTNDSNKNSDNSIKNDTDTQSSKQDKADNQKAPKSN
    USA300_FPR3757  TLIQNLFNLNSDISDYEQPRNGEKSTNDSNKNSDNSIKNDTDTQSSKQDKADNQKAPKSN
                    ************************************************************

    COL             NTKPSTSNKQPNSPKPTQPNQSNSQPASDDKANQKSSSKDNQSMSDSALDSILDQYSEDA
    N315            NTKPSTSNKQPNSPKPTQPNQSNSQPASDDKANQKSSSKDNQSMSDSALDSILDQYSEDA
    NCTC8325        NTKPSTSNKQPNSPKPTQPNQSNSQPASDDKANQKSSSKDNQSMSDSALDSILDQYSEDA
    Newman          NTKPSTSNKQPNSPKPTQPNQSNSQPASDDKANQKSSSKDNQSMSDSALDSILDQYSEDA
    USA300_FPR3757  NTKPSTSNKQPNSPKPTQPNQSNSQPASDDKANQKSSSKDNQSMSDSALDSILDQYSEDA
                    ************************************************************

    COL             KKTQKDYASQSKKDKNEKSNTKNPQLPTQDELKHKSKPAQSFNNDVNQKDTRATSLFETD
    N315            KKTQKDYASQSKKDKNEKSNTKNPQLPTQDELKHKSKPAQSFNNDVNQKDTRATSLFETD
    NCTC8325        KKTQKDYASQSKKDKNEKSNTKNPQLPTQDELKHKSKPAQSFNNDVNQKDTRATSLFETD
    Newman          KKTQKDYASQSKKDKNEKSNTKNPQLPTQDELKHKSKPAQSFNNDVNQKDTRATSLFETD
    USA300_FPR3757  KKAQKDYASQSKKDKNEKSNTKNPQLPTQDELKHKSKPAQSFNNDVNQKDTRATSLFETD
                    **:*********************************************************

    COL             PSISNNDDSGQFNVVDSKDTRQFVKSIAKDAHRIGQDNDIYASVMIAQAILESDSGRSAL
    N315            PSISNNDDSGQFNVVDSKDTRQFVKSIAKDAHRIGQDNDIYASVMIAQAILESDSGRSAL
    NCTC8325        PSISNNDDSGQFNVVDSKDTRQFVKSIAKDAHRIGQDNDIYASVMIAQAILESDSGRSAL
    Newman          PSISNNDDSGQFNVVDSKDTRQFVKSIAKDAHRIGQDNDIYASVMIAQAILESDSGRSAL
    USA300_FPR3757  PSISNNDDSGQFNVVDSKDTRQFVKSIAKDAHRIGQDNDIYASVMIAQAILESDSGRSAL
                    ************************************************************

    COL             AKSPNHNLFGIKGAFEGNSVPFNTLEADGNQLYSINAGFRKYPSTKESLKDYSDLIKNGI
    N315            AKSPNHNLFGIKGAFEGNSVPFNTLEADGNKLYSINAGFRKYPSTKESLKDYSDLIKNGI
    NCTC8325        AKSPNHNLFGIKGAFEGNSVPFNTLEADGNQLYSINAGFRKYPSTKESLKDYSDLIKNGI
    Newman          AKSPNHNLFGIKGAFEGNSVPFNTLEADGNQLYSINAGFRKYPSTKESLKDYSDLIKNGI
    USA300_FPR3757  AKSPNHNLFGIKGAFEGNSVPFNTLEADGNQLYSINAGFRKYPSTKESLKDYSDLIKNGI
                    ******************************:*****************************

    COL             DGNRTIYKPTWKSEADSYKDATSHLSKTYATDPNYAKKLNSIIKHYQLTQFDDERMPDLD
    N315            DGNRTIYKPTWKSEADSYKDATSHLSKTYATDPNYAKKLNSIIKHYQLTQFDDERMPDLD
    NCTC8325        DGNRTIYKPTWKSEADSYKDATSHLSKTYATDPNYAKKLNSIIKHYQLTQFDDERMPDLD
    Newman          DGNRTIYKPTWKSEADSYKDATSHLSKTYATDPNYAKKLNSIIKHYQLTQFDDERMPDLD
    USA300_FPR3757  DGNRTIYKPTWKSEADSYKDATSHLSKTYATDPNYAKKLNSIIKHYQLTQFDDERMPDLD
                    ************************************************************

    COL             KYERSIKDYDDSSDEFKPFREVSDSMPYPHGQCTWYVYNRMKQFGTSISGDLGDAHNWNN
    N315            KYERSIKDYDDSSDEFKPFREVSDSMPYPHGQCTWYVYNRMKQFGTSISGDLGDAHNWNN
    NCTC8325        KYERSIKDYDDSSDEFKPFREVSDSMPYPHGQCTWYVYNRMKQFGTSISGDLGDAHNWNN
    Newman          KYERSIKDYDDSSDEFKPFREVSDSMPYPHGQCTWYVYNRMKQFGTSISGDLGDAHNWNN
    USA300_FPR3757  KYERSIKDYDDSSDEFKPFREVSDSMPYPHGQCTWYVYNRMKQFGTSISGDLGDAHNWNN
                    ************************************************************

    COL             RAQYRDYQVSHTPKRHAAVVFEAGQFGADQHYGHVAFVEKVNSDGSIVISESNVKGLGII
    N315            RAQYRDYQVSHTPKRHAAVVFEAGQFGADQHYGHVAFVEKVNSDGSIVISESNVKGLGII
    NCTC8325        RAQYRDYQVSHTPKRHAAVVFEAGQFGADQHYGHVAFVEKVNSDGSIVISESNVKGLGII
    Newman          RAQYRDYQVSHTPKRHAAVVFEAGQFGADQHYGHVAFVEKVNSDGSIVISESNVKGLGII
    USA300_FPR3757  RAQYRDYQVSHTPKRHAAVVFEAGQFGADQHYGHVAFVEKVNSDGSIVISESNVKGLGII
                    ************************************************************

    COL             SHRTINAAAAEELSYITGK
    N315            SHRTINAAAAEELSYITGK
    NCTC8325        SHRTINAAAAEELSYITGK
    Newman          SHRTINAAAAEELSYITGK
    USA300_FPR3757  SHRTINAAAAEELSYITGK
                    *******************