From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006401000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6451593..6454737
  • synteny block?: BlockID0051080
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2596
    08BA02176:
    C248_2727
    11819-97:
    MS7_2662
    71193:
    ST398NM01_2709
    ECT-R 2:
    ECTR2_2511
    ED133:
    ED98:
    SAAV_2729
    HO 5096 0412:
    SAEMRSA15_25640
    JH1:
    SaurJH1_2738
    JH9:
    SaurJH9_2681
    JKD6008:
    JKD6159:
    SAA6159_02553
    LGA251:
    SARLGA251_24310
    M013:
    MRSA252:
    SAR2738
    MSHR1132:
    MSSA476:
    SAS2543
    Mu3:
    SAHV_2641
    Mu50:
    SAV2657
    MW2:
    RF122:
    SAB2532
    ST398:
    SAPIG2709
    T0131:
    SAT0131_02936
    TCH60:
    HMPREF0772_10529
    TW20:
    SATW20_27950
    USA300_TCH1516:
    USA300HOU_2657
    VC40:
    SAVC_12165

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MRTNDHITDLDAIELSSGWNYNSKLETGKNALLSDSLLRDIKVLSSNAKGDADILETEL
    N315            MMRTNNHITDLDAIELSSGWNYNSKLVTGKNALLSDSLLRDIKVLSSNAKGDADILETEL
    NCTC8325        -MRTNDHITDLDAIELSSGWNYNSKLETGKNALLSDSLLRDIKVLSSNAKGDADILETEL
    Newman          -MRTNDHITDLDAIELSSGWNYNSKLETGKNALLSDSLLRDIKVLSSNAKGDADILETEL
                     ****:******************** *********************************

    COL             RAVINSMSQNEGKSVDALKNSTASLKNNLTKLKEQLDKTTH
    N315            RAVINAMSQNEGKSVDALKNSTTSLKNNLTKLKEQLDKTTH
    NCTC8325        RAVINSMSQNEGKSVDALKNSTASLKNNLTKLKEQLDKTTH
    Newman          RAVINSMSQNEGKSVDALKNSTASLKNNLTKLKEQLDKTTH
                    *****:****************:******************