From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006405000
  • symbol?: msrA3
  • description?: methionine sulfoxide reductase A

      descriptions from strain specific annotations:

    • methionine sulfoxide reductase A
    • Peptide methionine sulfoxide reductase MsrA
    • methionine sulfoxide reductase A, MsrA
    • peptide methionine sulfoxide reductase family protein
    • peptide methionine sulfoxide reductase MsrA/msrB
    • peptide methionine sulfoxide reductase msrA/msrB domain protein
  • strand?: -
  • coordinates?: 6456096..6456572
  • synteny block?: BlockID0051120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2599 (msrA)
    08BA02176:
    C248_2730
    11819-97:
    MS7_2665
    71193:
    ST398NM01_2712
    ECT-R 2:
    ECTR2_2514
    ED133:
    SAOV_2712c
    ED98:
    SAAV_2732
    HO 5096 0412:
    SAEMRSA15_25670
    JH1:
    SaurJH1_2741
    JH9:
    SaurJH9_2684
    JKD6008:
    SAA6008_02720 (msrA)
    JKD6159:
    SAA6159_02556 (msrA)
    LGA251:
    SARLGA251_24340 (msrA3)
    M013:
    M013TW_2643
    MRSA252:
    SAR2741
    MSHR1132:
    SAMSHR1132_24880
    MSSA476:
    SAS2546
    Mu3:
    SAHV_2644
    Mu50:
    SAV2660
    MW2:
    MW2580
    RF122:
    SAB2535c
    ST398:
    SAPIG2712
    T0131:
    SAT0131_02939
    TCH60:
    HMPREF0772_10526 (msrA)
    TW20:
    SATW20_27980 (msrA3)
    USA300_TCH1516:
    USA300HOU_2660 (msrA3)
    VC40:
    SAVC_12180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLT
    N315            MVVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLT
    NCTC8325        MAVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLT
    Newman          MAVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLT
    USA300_FPR3757  MAVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLT
                    *.**********************************************************

    COL             ITDIMNYLFEIIDPYSVNQQGNDIGQKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEV
    N315            ITDIMNYLFEIIDPYSVNQQGNDIGEKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEV
    NCTC8325        ITDIMNYLFEIIDPYSVNQQGNDIGQKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEV
    Newman          ITDIMNYLFEIIDPYSVNQQGNDIGQKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEV
    USA300_FPR3757  ITDIMNYLFEIIDPYSVNQQGNDIGQKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEV
                    *************************:**********************************

    COL             LPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK
    N315            LPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK
    NCTC8325        LPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK
    Newman          LPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK
    USA300_FPR3757  LPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK
                    **************************************