From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006411000
  • symbol?: icaA
  • description?: N-glycosyltransferase

      descriptions from strain specific annotations:

    • N-glycosyltransferase
    • Intercellular adhesion protein A
    • Polysaccharide intercellular adhesin (PIA) biosynthesis N-glycosyltransferase IcaA
    • biofilm PIA synthesis N-glycosyltransferase icaA (Intercellular adhesion protein A)
    • intercellular adhesion protein IcaA
    • glucosaminyltransferase
    • chitin synthase
    • Poly-beta-1,6-N-acetyl-D-glucosamine synthase
    • intercellular adhesion protein A glucosaminyltransferase
    • N-acetylglucosaminyltransferase
  • strand?: +
  • coordinates?: 6461447..6462685
  • synteny block?: BlockID0051180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2689 (icaA)
    N315:
    SA2459 (icaA)
    NCTC8325:
    Newman:
    NWMN_2565 (icaA)
    USA300_FPR3757:
    04-02981:
    SA2981_2605 (icaA)
    08BA02176:
    C248_2736 (icaA)
    11819-97:
    MS7_2671 (pgaC)
    71193:
    ST398NM01_2718
    ECT-R 2:
    ECTR2_2520
    ED133:
    SAOV_2718
    ED98:
    SAAV_2738 (icaA)
    HO 5096 0412:
    SAEMRSA15_25730 (icaA)
    JH1:
    SaurJH1_2747
    JH9:
    SaurJH9_2690
    JKD6008:
    SAA6008_02726 (icaA)
    JKD6159:
    SAA6159_02562 (icaA)
    LGA251:
    SARLGA251_24400 (icaA)
    M013:
    M013TW_2649
    MRSA252:
    SAR2747 (icaA)
    MSHR1132:
    SAMSHR1132_24940
    MSSA476:
    SAS2552
    Mu3:
    SAHV_2650 (icaA)
    Mu50:
    SAV2666 (icaA)
    MW2:
    MW2586 (icaA)
    RF122:
    SAB2541 (icaA)
    ST398:
    SAPIG2718
    T0131:
    SAT0131_02945 (vraD)
    TCH60:
    HMPREF0772_10520 (pgaC)
    TW20:
    SATW20_28040 (icaA)
    USA300_TCH1516:
    USA300HOU_2666 (icaA)
    VC40:
    SAVC_12210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE
    N315            MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE
    NCTC8325        MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE
    Newman          MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE
    USA300_FPR3757  MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE
                    ************************************************************

    COL             TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ
    N315            TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ
    NCTC8325        TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ
    Newman          TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ
    USA300_FPR3757  TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ
                    ************************************************************

    COL             GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE
    N315            GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE
    NCTC8325        GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE
    Newman          GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE
    USA300_FPR3757  GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE
                    ************************************************************

    COL             YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR
    N315            YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR
    NCTC8325        YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR
    Newman          YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR
    USA300_FPR3757  YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR
                    ************************************************************

    COL             IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS
    N315            IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS
    NCTC8325        IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS
    Newman          IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS
    USA300_FPR3757  IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS
                    ************************************************************

    COL             ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK
    N315            ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK
    NCTC8325        ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK
    Newman          ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK
    USA300_FPR3757  ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK
                    ************************************************************

    COL             KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR
    N315            KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR
    NCTC8325        KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR
    Newman          KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR
    USA300_FPR3757  KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR
                    ****************************************************