From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006427000
  • symbol?: hisI
  • description?: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase

      descriptions from strain specific annotations:

    • bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase
    • bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
    • bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP
    • bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein
    • histidine biosynthesis bifunctional protein hisIE
    • histidine biosynthesisl protein
    • imidazole glycerol phosphate synthase subunit HisF
    • Phosphoribosyl-AMP cyclohydrolase / Phosphoribosyl-ATP pyrophosphatase
    • phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase
    • phosphoribosyl-ATP diphosphatase
    • putative histidine biosynthesis bifunctional protein
  • strand?: -
  • coordinates?: 6470709..6471341
  • synteny block?: BlockID0051340
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2696 (hisI)
    N315:
    SA2464 (hisI)
    NCTC8325:
    Newman:
    NWMN_2570 (hisIE)
    USA300_FPR3757:
    SAUSA300_2605 (hisIE)
    04-02981:
    SA2981_2612 (hisI)
    08BA02176:
    C248_2741 (hisIE)
    11819-97:
    MS7_2677 (hisE)
    71193:
    ST398NM01_2723
    ECT-R 2:
    ECTR2_2525 (hisE)
    ED133:
    SAOV_2723c
    ED98:
    SAAV_2745 (hisI)
    HO 5096 0412:
    SAEMRSA15_25780 (hisIE)
    JH1:
    SaurJH1_2753
    JH9:
    SaurJH9_2696
    JKD6008:
    SAA6008_02731 (hisI)
    JKD6159:
    SAA6159_02569 (hisI)
    LGA251:
    SARLGA251_24450 (hisIE)
    M013:
    M013TW_2655
    MRSA252:
    SAR2754 (hisIE)
    MSHR1132:
    SAMSHR1132_24990
    MSSA476:
    SAS2557
    Mu3:
    SAHV_2656 (hisI)
    Mu50:
    SAV2672 (hisI)
    MW2:
    MW2591 (hisI)
    RF122:
    SAB2548c (hisIE)
    ST398:
    SAPIG2723
    T0131:
    SAT0131_02951 (msrB)
    TCH60:
    HMPREF0772_10514 (hisI)
    TW20:
    SATW20_28090 (hisIE)
    USA300_TCH1516:
    USA300HOU_2673 (hisIE)
    VC40:
    SAVC_12235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNYKIDFSKGLVPAILQDNQTKQVLMLGYMNQEAFDKTIEDGVVCFYSRSKQRLWTKGE
    N315            MTKYKIDFSKGLVPAILQDNQTKQVLMLGYMNQEAFDKTIEDGVVCFYSRSKQRLWTKGE
    Newman          MTKYKIDFSKGLVPAILQDNQTKQVLMLGYMNQEAFDKTIEDGVVCFYSRSKQRLWTKGE
    USA300_FPR3757  MTKYKIDFSKGLVPAILQDNQTKQVLMLGYMNQEAFDKTIEDGVVCFYSRSKQRLWTKGE
                    **:*********************************************************

    COL             TSGHTQRVKDIHVDCDNDTILIDVIPNGPTCHTGSQSCFNTEVPFSVQTLAQTVQDSAQS
    N315            TSGHTQLVKDIHVDCDNDTILIDVIPNGPTCHTGSQSCFNTEVPFSVQTLAQTVQDSAQS
    Newman          TSGHTQRVKDIHVDCDNDTILIDVIPNGPTCHTGSQSCFNTEVPFSVQTLAQTVQDSAQS
    USA300_FPR3757  TSGHTQRVKDIHVDCDNDTILIDVIPNGPTCHTGSQSCFNTEVPFSVQTLAQTVQDSAQS
                    ****** *****************************************************

    COL             NNEKSYTKYLLTEGIEKITKKYGEEAFEVVIEAIKGDKKAFVSEVADELYHLFVLMHALG
    N315            NNEKSYTKYLLTEGIEKITKKYGEEAFEVVIEAIKGDKKAFVSEVADELYHLFVLMHALG
    Newman          NNEKSYTKYLLTEGIEKITKKYGEEAFEVVIEAIKGDKKAFVSEVADELYHLFVLMHALG
    USA300_FPR3757  NNEKSYTKYLLTEGIEKITKKYGEEAFEVVIEAIKGDKKAFVSEVADELYHLFVLMHALG
                    ************************************************************

    COL             VDFSEIEAELARRHHKRNNFKGERQNIEQW
    N315            VDFSEIEAELARRHHKRNNFKGERQNIEQW
    Newman          VDFSEIEAELARRHHKRNNFKGERQNIEQW
    USA300_FPR3757  VDFSEIEAELARRHHKRNNFKGERQNIEQW
                    ******************************