From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006440000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ABC superfamily ATP binding cassette transporter, membrane protein
    • Putative ABC transporter ATP-binding protein
    • cobalt ABC transporter ATPase
    • ATPase component MtsB
    • ATP-binding ABC transporter
    • Duplicated ATPase component MtsB of energizing module of methionine-regulated ECF transporter
    • ABC transporter family protein
    • putative cobalt ABC transporter ATP-binding protein
    • heme ABC transporter ATP-binding protein CcmA
  • strand?: -
  • coordinates?: 6480653..6482260
  • synteny block?: BlockID0051470
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2624 (mtsB)
    08BA02176:
    11819-97:
    MS7_2689
    71193:
    ECT-R 2:
    ECTR2_2537
    ED133:
    ED98:
    SAAV_2758
    HO 5096 0412:
    JH1:
    SaurJH1_2765
    JH9:
    SaurJH9_2708
    JKD6008:
    SAA6008_02743
    JKD6159:
    SAA6159_02581
    LGA251:
    M013:
    M013TW_2667
    MRSA252:
    SAR2766
    MSHR1132:
    SAMSHR1132_25120
    MSSA476:
    SAS2569
    Mu3:
    SAHV_2668
    Mu50:
    SAV2684
    MW2:
    MW2603
    RF122:
    SAB2560c
    ST398:
    T0131:
    SAT0131_02963
    TCH60:
    HMPREF0772_10502
    TW20:
    SATW20_28210
    USA300_TCH1516:
    USA300HOU_2686
    VC40:
    SAVC_12295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEPIISFKDFSFQYHSQATPTLQNINVDIYPGEKVLVVGASGSGKSTFANCINGLIPFK
    N315            -----------------------------------MLVVGASGSGKSTFANCINGLIPFK
    NCTC8325        MTEPIISFKDFSFQYHSQATPTLQNINVDIYPGEKVLVVGASGSGKSTFANCINGLIPFK
    Newman          MTEPIISFKDFSFQYHSQATPTLQNINVDIYPGEKVLVVGASGSGKSTFANCINGLIPFK
    USA300_FPR3757  MTEPIISFKDFSFQYHSQATPTLQNINVDIYPGEKVLVVGASGSGKSTFANCINGLIPFK
                                                       :************************

    COL             TKGNITGELYINNQDATVSCLHDRSNVVGTVLQDTDGQFIGLTAAEDMAFLLENNCVEQD
    N315            TKGNITGELYINNQDATVSCLHDRSNVVGTVLQDTDGQFIGLTAAEDMAFLLENNCVEQD
    NCTC8325        TKGNITGELYINNQDATVSCLHDRSNVVGTVLQDTDGQFIGLTAAEDMAFLLENNCVEQD
    Newman          TKGNITGELYINNQDATVSCLHDRSNVVGTVLQDTDGQFIGLTAAEDMAFLLENNCVEQD
    USA300_FPR3757  TKGNITGELYINNQDATVSCLHDRSNVVGTVLKDTDGQFIGLTAAEDMAFLLENNCVEQD
                    ********************************:***************************

    COL             DMKKNVSYWAEKVGMIEHLNHRPQDLSGGQKQRVSLGGILIHRTPILILDEPLANLDPAT
    N315            DMKKNVSYWAEKVGMIEHLNHRPQDLSGGQKQRVSLGGILIHRTPILILDEPLANLDPAT
    NCTC8325        DMKKNVSYWAEKVGMIEHLNHRPQDLSGGQKQRVSLGGILIHRTPILILDEPLANLDPAT
    Newman          DMKKNVSYWAEKVGMIEHLNHRPQDLSGGQKQRVSLGGILIHRTPILILDEPLANLDPAT
    USA300_FPR3757  DMKKNVSYWAEKVGMIEHLNHRPQDLSGGQKQRVSLGGILIHRTPILILDEPLANLDPAT
                    ************************************************************

    COL             GHETLRLLNNIHEETKSTMIIVEHRLEESLDDTFDRVLLFKDGKIIANTTPSDLLKSSKL
    N315            GHETLRLLNNIHEETKSTMIIVEHRLEESLDDTFDRVLLFKDGKIIANTTPSDLLKSSKL
    NCTC8325        GHETLRLLNNIHEETKSTMIIVEHRLEESLDDTFDRVLLFKDGKIIANTTPSDLLKSSKL
    Newman          GHETLRLLNNIHEETKSTMIIVEHRLEESLDDTFDRVLLFKDGKIIANTTPSDLLKSSKL
    USA300_FPR3757  GHETLRLLNNIHEETKSTMIIVEHRLEESLDDTFDRVLLFKDGKIIANTTPSDLLKSSKL
                    ************************************************************

    COL             KEAGIREPLYCTALKYAEVDVESIDNLANLRDVCMSEHVKFKVKKWIDETSANNDNKYKS
    N315            KEAGIREPLYCTALKYAEVDVESIDNLANLRDVCMSEHVKFKVKKWIDETSANNDNKYKS
    NCTC8325        KEAGIREPLYCTALKYAEVDVESIDNLANLRDVCMSEHVKFKVKKWIDETSANNDNKYKS
    Newman          KEAGIREPLYCTALKYAEVDVESIDNLANLRDVCMSEHVKFKVKKWIDETSANNDNKYKS
    USA300_FPR3757  KEAGIREPLYCTALKYAEVDVESIDNLANLRDVCMSEHVKFKVKKWIDETSANNDNKYKS
                    ************************************************************

    COL             EPLLELNEVCVQYSDYSNSVLNNVQLNVYRREMLSIVGHNGAGKSTLAKAICGFLDITGN
    N315            EPLLELNEVCVQYSDYSNSVLNNVQLNVYRREMLSIVGHNGAGKSTLAKAICGFLDITGN
    NCTC8325        EPLLELNEVCVQYSDYSNSVLNNVQLNVYRKEMLSIVGHNGAGKSTLAKAICGFLDITGN
    Newman          EPLLELNEVCVQYSDYSNSVLNNVQLNVYRREMLSIVGHNGAGKSTLAKAICGFLDITGN
    USA300_FPR3757  EPLLELNEVCVQYSDYSNSVLNNVQLNVYRREMLSIVGHNGAGKSTLAKAICGFLDITGN
                    ******************************:*****************************

    COL             IQFCNRGFNQLSISERSEFVGYVMQNPNHMISEKMIYDEVALGLRARGMKESDIKIRVEN
    N315            IQFCNRGFNQLSISERSEFVGYVMQNPNHMISEKMIYDEVALGLRARGMKESDIKIRVEN
    NCTC8325        IQFCNRGFNQLSISERSEFVGYVMQNPNHMISEKMIYDEVALGLRARGMKESDIKIRVEN
    Newman          IQFCNRGFNQLSISERSEFVGYVMQNPNHMISEKMIYDEVALGLRARGMKESDIKIRVEN
    USA300_FPR3757  IQFCNRGFNQLSISERSEFVGYVMQNPNHMISEKMIYDEVALGLRARGMKESDIKIRVEN
                    ************************************************************

    COL             VLKICGLYAFRNWPIAALSYGQKKRVTIASVLVLNPEIIILDEPTAGQDFYHYNEIMSFL
    N315            VLKICGLYAFRNWPIAALSYGQKKRVTIASVLVLNPEIIILDEPTAGQDFYHYNEIMSFL
    NCTC8325        VLKICGLYAFRNWPIAALSYGQKKRVTIASVLVLNPEIIILDEPTAGQDFYHYNEIMSFL
    Newman          VLKICGLYAFRNWPIAALSYGQKKRVTIASVLVLNPEIIILDEPTAGQDFYHYNEIMSFL
    USA300_FPR3757  VLKICGLYAFRNWPIAALSYGQKKRVTIASVLVLNPEIIILDEPTAGQDFYHYNEIMSFL
                    ************************************************************

    COL             IELNRQGKTIIMITHDMHLLSEYSSRTVVLSKGQVVADTTPVLVLNDKKICEIASLRQTS
    N315            IELNRQGKTIIMITHDMHLLSEYSSRTVVLSKGQVVADTTPVLILNDKKICEIASLRQTS
    NCTC8325        IELNRQGKTIIMITHDMHLLSEYSSRTVVLSKGQVVADTTPVLVLNDKKICEIASLRQTS
    Newman          IELNRQGKTIIMITHDMHLLSEYSSRTVVLSKGQVVADTTPVLVLNDKKICEIASLRQTS
    USA300_FPR3757  IELNRQGKTIIMITHDMHLLSEYSSRTVVLSKGQVVADTTPVLVLNDKKICEIASLRQTS
                    *******************************************:****************

    COL             LFEMAEYIGISEPQKLVQLFINHDRKVRRQ
    N315            LFEMAEYIGISEPQKLVQLFINHDRKVRRQ
    NCTC8325        LFEMAEYIGISEPQKLVQLFINHDRKVRRQ
    Newman          LFEMAEYIGISEPQKLVQLFINHDRKVRRQ
    USA300_FPR3757  LFEMAEYIGISEPQKLVQLFINHDRKVRRQ
                    ******************************