From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006441000
  • symbol?:
  • description?: Substrate-specific component MtsA of methionine-regulated ECF transporter

      descriptions from strain specific annotations:

    • Substrate-specific component MtsA of methionine-regulated ECF transporter
    • membrane protein
  • strand?: -
  • coordinates?: 6482418..6482972
  • synteny block?: BlockID0051480
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2625 (mtsA)
    08BA02176:
    11819-97:
    MS7_2690
    71193:
    ECT-R 2:
    ECTR2_2538
    ED133:
    ED98:
    SAAV_2759
    HO 5096 0412:
    JH1:
    SaurJH1_2766
    JH9:
    SaurJH9_2709
    JKD6008:
    SAA6008_02744
    JKD6159:
    SAA6159_02582
    LGA251:
    M013:
    M013TW_2668
    MRSA252:
    SAR2767
    MSHR1132:
    SAMSHR1132_25130
    MSSA476:
    SAS2570
    Mu3:
    SAHV_2669
    Mu50:
    SAV2685
    MW2:
    MW2604
    RF122:
    SAB2561c
    ST398:
    T0131:
    SAT0131_02964
    TCH60:
    HMPREF0772_10501
    TW20:
    SATW20_28220
    USA300_TCH1516:
    USA300HOU_2687
    VC40:
    SAVC_12300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM
    N315            MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM
    NCTC8325        MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM
    Newman          MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM
    USA300_FPR3757  MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLM
                    ************************************************************

    COL             TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII
    N315            TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGLFSRKSMIYFNIGQII
    NCTC8325        TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII
    Newman          TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII
    USA300_FPR3757  TGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQII
                    ******************************************** ******:********

    COL             ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS
    N315            ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS
    NCTC8325        ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS
    Newman          ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS
    USA300_FPR3757  ANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGS
                    ************************************************************

    COL             LRKE
    N315            LRKE
    NCTC8325        LRKE
    Newman          LRKE
    USA300_FPR3757  LRKE
                    ****