From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006453000
  • symbol?:
  • description?: 2-oxoglutarate/malate translocator

      descriptions from strain specific annotations:

    • 2-oxoglutarate/malate translocator
    • anion transporter
    • anion transporter family protein
    • 2-oxoglutarate/malate translocator-like protein
    • 2-oxoglutarate/malate translocator, chloroplast
    • 2-oxoglutarate-malate translocator
    • sodium, sulfate symporter
    • DASS family divalent anion:sodium (Na+) symporter
    • sodium:sulfate symporter family protein
    • Na+ symporter family protein
  • strand?: +
  • coordinates?: 6499911..6500730
  • synteny block?: BlockID0051600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2634
    08BA02176:
    C248_2759
    11819-97:
    MS7_2700
    71193:
    ST398NM01_2741
    ECT-R 2:
    ECTR2_2547
    ED133:
    SAOV_2738
    ED98:
    SAAV_2767
    HO 5096 0412:
    SAEMRSA15_25940
    JH1:
    SaurJH1_2775
    JH9:
    SaurJH9_2718
    JKD6008:
    SAA6008_02752
    JKD6159:
    SAA6159_02589
    LGA251:
    SARLGA251_24610
    M013:
    M013TW_2677
    MRSA252:
    SAR2775
    MSHR1132:
    SAMSHR1132_25230
    MSSA476:
    SAS2579
    Mu3:
    SAHV_2678
    Mu50:
    SAV2694
    MW2:
    MW2613
    RF122:
    SAB2571
    ST398:
    SAPIG2741
    T0131:
    SAT0131_02972
    TCH60:
    HMPREF0772_10493
    TW20:
    SATW20_28300
    USA300_TCH1516:
    USA300HOU_2696
    VC40:
    SAVC_12345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENTVKYRKFILPIVVGLLIWALTPFKPDAVDPTAWYMFAIFVATIIACITQPMPIGAVS
    N315            MENTVKYRKFILPIVVGLLIWALTPFKPDAVDPTAWYMFAIFVATIIACITQPMPIGAVS
    NCTC8325        MENTVKYRKFILPIVVGLLIWALTPFKPDAVDPTAWYMFAIFVATIIACITQPMPIGAVS
    Newman          MENTVKYRKFILPIVVGLLIWALTPFKPDAVDPTAWYMFAIFVATIIACITQPMPIGAVS
    USA300_FPR3757  MENTVKYRKFILPIVVGLLIWALTPFKPDAVDPTAWYMFAIFVATIIACITQPMPIGAVS
                    ************************************************************

    COL             IIGFTIMVLVGIVDMKTAVAGFGNNSIWLIAMAFFISRGFVKTGLGRRIALHFVKLFGKK
    N315            IIGFTIMVLVGIVDMKTAVAGFGNNSIWLIAMAFFISRGFVKTGLGRRIALHFVKLFGKK
    NCTC8325        IIGFTIMVLVGIVDMKTAVAGFGNNSIWLIAMAFFISRGFVKTGLGRRIALHFVKLFGKK
    Newman          IIGFTIMVLVGIVDMKTAVAGFGNNSIWLIAMAFFISRGFVKTGLGRRIALHFVKLFGKK
    USA300_FPR3757  IIGFTIMVLVGIVDMKTAVAGFGNNSIWLIAMAFFISRGFVKTGLGRRIALHFVKLFGKK
                    ************************************************************

    COL             TLGLAYSIVGVDLILAPATPSNTARAGGIMFPIIKSLSESFGSKPKDGSARKMGAFLVFT
    N315            TLGLAYSIVGVDLILAPATPSNTARAGGIMFPIIKSLSESFGSKPKDGSARKMGAFLVFT
    NCTC8325        TLGLAYSIVGVDLILAPATPSNTARAGGIMFPIIKSLSESFGSKPKDGSARKMGAFLVFT
    Newman          TLGLAYSIVGVDLILAPATPSNTARAGGIMFPIIKSLSESFGSKPKDGSARKMGAFLVFT
    USA300_FPR3757  TLGLAYSIVGVDLILAPATPSNTARAGGIMFPIIKSLSESFGSKPKDGSARKMGAFLVFT
                    ************************************************************

    COL             EFQGNLITAAMFLTAMAGNPLAQNLASSTSNVHITWMNWFLAALVPGLVSLIVVPFIIYK
    N315            EFQGNLITAAMFLTAMAGNPLAQNLASSTSNVHITWMNWFLAALVPGLVSLIVVPFIIYK
    NCTC8325        EFQGNLITAAMFLTAMAGNPLAQNLASSTSNVHITWMNWFLAALVPGLVSLIVVPFIIYK
    Newman          EFQGNLITAAMFLTAMAGNPLAQNLASSTSNVHITWMNWFLAALVPGLVSLIVVPFIIYK
    USA300_FPR3757  EFQGNLITAAMFLTAMAGNPLAQNLASSTSNVHITWMNWFLAALVPGLVSLIVVPFIIYK
                    ************************************************************

    COL             IYPPTVKETPNAKSWAENELATMGKIALAEKFMIGIFVVALTLWIVGSFIHIDATLTAFI
    N315            IYPPTVKETPNAKSWAENELATMGKIALAEKFMIGIFVIALTLWIVGSFIHIDATLTAFI
    NCTC8325        IYPPTVKETPNAKSWAENELATMGKIALAEKFMIGIFVVALTLWIVGSFIHIDATLTAFI
    Newman          IYPPTVKETPNAKSWAENELATMGKIALAEKFMIGIFVVALTLWIVGSFIHIDATLTAFI
    USA300_FPR3757  IYPPTVKETPNAKSWAENELATMGKIALAEKFMIGIFVVALTLWIVGSFIHIDATLTAFI
                    **************************************:*********************

    COL             ALALLLLTGVLTWQDILNETGAWNTLVWFSVLVLMADQLNKLGFIPWLSKSIATSLGGLS
    N315            ALALLLLTGVLTWQDILNETGAWNTLVWFSVLVLMADQLNKLGFIPWLSKSIATSLGGLS
    NCTC8325        ALALLLLTGVLTWQDILNETGAWNTLVWFSVLVLMADQLNKLGFIPWLSKSIATSLGGLS
    Newman          ALALLLLTGVLTWQDILNETGAWNTLVWFSVLVLMADQLNKLGFIPWLSKSIATSLGGLS
    USA300_FPR3757  ALALLLLTGVLTWQDILNETGAWNTLVWFSVLVLMADQLNKLGFIPWLSKSIATSLGGLS
                    ************************************************************

    COL             WPIVLVILILFYFYSHYLFASSTAHISAMYAALLGVAIAAGAPPLFSALMLGFFGNLLAS
    N315            WPIVLVILILFYFYSHYLFASSTAHISAMYAALLGVAIAAGAPPLFSALMLGFFGNLLAS
    NCTC8325        WPIVLVILILFYFYSHYLFASSTAHISAMYAALLGVAIAAGAPPLFSALMLGFFGNLLAS
    Newman          WPIVLVILILFYFYSHYLFASSTAHISAMYAALLGVAIAAGAPPLFSALMLGFFGNLLAS
    USA300_FPR3757  WPIVLVILILFYFYSHYLFASSTAHISAMYAALLGVAIAAGAPPLFSALMLGFFGNLLAS
                    ************************************************************

    COL             TTHYSSGPAPILFSSGYVTQKRWWTMNLILGFVYFIIWIGLGSLWMKVIGIF
    N315            TTHYSSGPAPILFSSGYVTQKRWWTMNLILGFVYFIIWIGLGSLWMKVIGIF
    NCTC8325        TTHYSSGPAPILFSSGYVTQKRWWTMNLILGFVYFIIWIGLGSLWMKVIGIF
    Newman          TTHYSSGPAPILFSSGYVTQKRWWTMNLILGFVYFIIWIGLGSLWMKVIGIF
    USA300_FPR3757  TTHYSSGPAPILFSSGYVTQKRWWTMNLILGFVYFIIWIGLGSLWMKVIGIF
                    ****************************************************