From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006465000
  • symbol?: vraD
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • bacitracin export ATP-binding protein bceA
    • ABC transporter ATP-binding protein, involved in vancomycin resistance
    • SalX, ABC-type antimicrobial peptide transport system, involved in vancomycin resistance
    • ABC transporter family protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • Bacitracin transport ATP-binding protein
  • strand?: +
  • coordinates?: 6507212..6507970
  • synteny block?: BlockID0051720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2492 (vraD)
    NCTC8325:
    Newman:
    NWMN_2598 (vraD)
    USA300_FPR3757:
    04-02981:
    SA2981_2640 (vraD)
    08BA02176:
    C248_2767 (vraD)
    11819-97:
    MS7_2706
    71193:
    ST398NM01_2747
    ECT-R 2:
    ECTR2_2553
    ED133:
    SAOV_2744
    ED98:
    SAAV_2773
    HO 5096 0412:
    SAEMRSA15_26000 (vraD)
    JH1:
    SaurJH1_2781
    JH9:
    SaurJH9_2724
    JKD6008:
    SAA6008_02758 (vraD)
    JKD6159:
    SAA6159_02595 (vraD)
    LGA251:
    SARLGA251_24670 (vraD)
    M013:
    M013TW_2684
    MRSA252:
    SAR2781 (vraD)
    MSHR1132:
    SAMSHR1132_25290
    MSSA476:
    SAS2585
    Mu3:
    SAHV_2685 (vraD)
    Mu50:
    SAV2701 (vraD)
    MW2:
    MW2620 (vraD)
    RF122:
    SAB2578 (vraD)
    ST398:
    SAPIG2747
    T0131:
    SAT0131_02978
    TCH60:
    HMPREF0772_10486
    TW20:
    SATW20_28360 (vraD)
    USA300_TCH1516:
    USA300HOU_2703
    VC40:
    SAVC_12375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISS
    N315            MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISS
    NCTC8325        MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISS
    Newman          MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISS
    USA300_FPR3757  MTILSVQHVSKTYGKKHTFQALKDINFDIQKGEFVAIMGPSGSGKTTLLNVLSSIDQISS
                    ************************************************************

    COL             GSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATME
    N315            GSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATME
    NCTC8325        GSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATME
    Newman          GSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATME
    USA300_FPR3757  GSVIANGQELNKLNQKALAKFRKESLGFIFQDYSILPTLTVKENIMLPLSVQKMSKATME
                    ************************************************************

    COL             ENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSAND
    N315            ENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSAND
    NCTC8325        ENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSAND
    Newman          ENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSAND
    USA300_FPR3757  ENYKAITTALGIYDLGNKYPSELSGGQQQRTAAARAFVHKPQIIFADEPTGALDSKSAND
                    ************************************************************

    COL             LLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVH
    N315            LLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVH
    NCTC8325        LLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVH
    Newman          LLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVH
    USA300_FPR3757  LLQRLEEMNKSFDTTIVMVTHDPVAASFAERVIMLKDGQIHTQLYQEGRSKQAFYEDIVH
                    ************************************************************

    COL             LQSVLGGVSNDI
    N315            LQSVLGGVSNDI
    NCTC8325        LQSVLGGVSNDI
    Newman          LQSVLGGVSNDI
    USA300_FPR3757  LQSVLGGVSNDI
                    ************