From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006479000
  • symbol?: cspB
  • description?: cold shock protein cspB

      descriptions from strain specific annotations:

    • cold shock protein cspB
    • CSD family cold shock protein
    • cold-shock DNA-binding domain-containing protein
    • DNA-binding cold-shock protein
    • Cold shock protein CspG
    • cold shock protein, CSD family
    • cold shock protein B
    • cold shock protein cspC
    • cspD: cold shock domain-containing protein CspD
  • strand?: +
  • coordinates?: 6516373..6516600
  • synteny block?: BlockID0051860
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2494 (cspB)
    NCTC8325:
    Newman:
    NWMN_2605 (cspB)
    USA300_FPR3757:
    04-02981:
    SA2981_2643 (cspG)
    08BA02176:
    C248_2770 (cspD)
    11819-97:
    MS7_2709 (cspC)
    71193:
    ST398NM01_2750
    ECT-R 2:
    ECTR2_2556
    ED133:
    SAOV_2747
    ED98:
    SAAV_2776
    HO 5096 0412:
    JH1:
    SaurJH1_2784
    JH9:
    SaurJH9_2727
    JKD6008:
    SAA6008_02766
    JKD6159:
    SAA6159_02598
    LGA251:
    SARLGA251_24690 (cspB)
    M013:
    M013TW_2691
    MRSA252:
    SAR2790 (cspB)
    MSHR1132:
    SAMSHR1132_25320
    MSSA476:
    SAS2587
    Mu3:
    SAHV_2688 (cspB)
    Mu50:
    SAV2704 (cspB)
    MW2:
    MW2623 (cspB)
    RF122:
    SAB2581 (cspB)
    ST398:
    SAPIG2750
    T0131:
    SAT0131_02987
    TCH60:
    HMPREF0772_10478 (cspB)
    TW20:
    SATW20_28420 (cspB)
    USA300_TCH1516:
    VC40:
    SAVC_12410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEI
    N315            ---------MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEI
    NCTC8325        MQKHTEVFYMNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEI
    Newman          ---------MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEI
    USA300_FPR3757  MQKHTEVFYMNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEI
                             ***************************************************

    COL             TEGQRGDQAVNVQTV
    N315            TEGQRGDQAVNVQTV
    NCTC8325        TEGQRGDQAVNVQTV
    Newman          TEGQRGDQAVNVQTV
    USA300_FPR3757  TEGQRGDQAVNVQTV
                    ***************